Search
Invitrogen
TANK Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 12
TANK Antibody (PA5-95584) in IHC (P)
Immunohistochemical analysis of TANK in paraffin-embedded section of mouse kidney tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/mL rabbit anti-TANK antibody (Product # PA5-95584) overnight at 4°C. Biotinylated goat anti-rabbit IgG was us... View More
Product Details
PA5-95584
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human TANK (MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQK) (aa 1-33).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat brain tissue, rat lung tissue, rat spleen tissue, rat kidney tissue, mouse brain tissue, mouse lung tissue, mouse spleen tissue, mouse kidney tissue, human Hela whole cell, human A549 whole cell, human MDA-MB-453 whole cell, human SW620 whole cell. IHC: rat small intestine tissue, human cholangiocarcinoma tissue, human placenta tissue, rat spleen tissue, human rectal cancer tissue, mouse kidney tissue, mouse liver tissue IHC-F: human placenta tissue. Flow: A431 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
TANK was initially identified as a novel TRAF-interacting protein that regulated TRAF-mediated signal transduction. Specifically, ligand binding by surface receptors in the tumor necrosis factor (TNF) receptor and Toll/interleukin-1 (IL-1) receptor families lead to the formation of a TRAF/TANK complex that mediates the activation of the transcription factor NF-kappa-B. This activation of NF-kappa-B occurs through an association with the kinases IKK-iota and TBK1. More recently, it was shown that these proteins can then form a complex with NEMO, a protein that regulates the activity of the Ikappa-B complex. This suggests that in addition to the possibility that TBK1 and IKK-iota activate the IKKs, the association with the IKK complex may help these kinases modulate other functions, such as the transactivation potential of NF-kappa-B proteins. At least two isoforms of TANK are known to exist.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: I-TRAF; OTTHUMP00000200694; OTTHUMP00000200695; OTTHUMP00000200696; OTTHUMP00000200698; OTTHUMP00000200700; OTTHUMP00000200703; OTTHUMP00000200704; TRAF family member-associated Nf-kappa B activator; TRAF family member-associated NF-kappa-B activator; TRAF interacting protein TANK; TRAF-interacting protein; unnamed protein product
Gene Aliases: C86182; E430026L09Rik; I-TRAF; ITRAF; TANK; TRAF2
UniProt ID: (Human) Q92844, (Mouse) P70347
Entrez Gene ID: (Human) 10010, (Rat) 252961, (Mouse) 21353
cellular response to DNA damage stimulus
signal transduction
negative regulation of tumor necrosis factor-mediated signaling pathway
positive regulation of type I interferon production
negative regulation of I-kappaB kinase/NF-kappaB signaling
defense response to virus
type I interferon signaling pathway
cellular response to interleukin-1
cellular response to tumor necrosis factor
cellular response to ionizing radiation
positive regulation of protein deubiquitination
positive regulation of ubiquitin-specific protease activity
I-kappaB kinase/NF-kappaB signaling
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support