Search
Search
Invitrogen
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
The Human Apelin 36 (AP36) ELISA quantitates AP36 in serum, plasma and other biological fluids.
Principle of the method
The Competitive Alpha Melanocyte Stimulating Hormone (aMSH) ELISA research use only kit is designed to quantitatively measure aMSH in humans. An aMSH standard is provided to generate a standard curve for the assay and all samples are read off a user generated standard curve. Standards or diluted samples are pipetted into a coated microtiter plate and Biotinylated Detection Ab specific to Human aMSH is added. Excess conjugate and unbound sample or standard are washed from the plate, and Avidin conjugated to Horseradish Peroxidase (HRP) is added to each well and incubated. Then a TMB substrate solution is added to each well. The enzyme substrate reaction is terminated by the addition of stop solution and the color change is measured on a microplate reader. The concentration of Human aMSH in the samples is then determined by comparing the OD of the samples to the standard curve.
Rigorous validation:
Each manufactured lot of this ELISA kit is quality tested for criteria such as sensitivity, specificity, precision, and lot-to-lot consistency. See manual for more information on validation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Apelin-36 is a peptide hormone that regulates cardiovascular function, fluid balance, and metabolism. It acts as a ligand for the apelin receptor and has vasodilatory effects, influences fluid balance, and potentially affects energy metabolism. It is produced by various tissues and consists of 36 amino acids (ARVYIHPNSYCFGGHLMDRFRNPTYLPLGCVRF-NH2)
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases : Apelin 36, apelin-36
If an Invitrogen™ immunoassay doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support