Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Cell Analysis
    • Antibodies
    • Mass Spectrometry
    • Cell Culture
    • Laboratory Instruments
    • Clinical and Diagnostics
    • Chromatography
    • Laboratory Equipment
    • Laboratory Supplies
    • Molecular Biology and Nucleic Acid Analysis
    • Sequence-Specific Nucleic Acid Products
    • See all product categories
  • Applications
    • Cell Culture and Transfection
    • Flow Cytometry
    • Cancer Research
    • Chromatography
    • Sequencing
    • PCR
    • Lab Solutions
    • Allergy Diagnostics
    • See all applications and techniques
  • Services
    • Cell Biology Services
    • Custom Services
    • Training Services
    • Lab Informatics Services
    • Financial and Leasing Services
    • Partnering and Licensing Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Food Safety Inspection Services
    • See all services
  • Help and Support
    • How to Order
    • Promotions and Online Offers
    • Contact Us
    • Change Location
    • Create a New Account
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Special Offers
  • Contact Us
  • Quick Order
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Contact Us
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
          • ELISA Kits ›
          • AP36 ELISA Kits

          Invitrogen

          Human AP36 Competitive ELISA Kit

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Technical guide & protocol Tech Support
          Technical guide & protocol Tech Support
          Technical guide & protocol Tech Support
          Technical guide & protocol Tech Support
          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          Human AP36 Competitive ELISA Kit
          Group 53 Created with Sketch.
          Human AP36 Competitive ELISA Kit
          Group 53 Created with Sketch.

          FIGURE: 1 / 3

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          Human AP36 Competitive ELISA Kit

          ELISA Standard Curve of AP36 using Human AP36 Competitive ELISA Kit (Product # EEL169). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          Human AP36 Competitive ELISA Kit
          Human AP36 Competitive ELISA Kit (EEL169)
          videoThumbnail
          ►

          Product Specifications

          Analytical sensitivity

          28.13 pg/mL

          Assay range

          46.88-3,000 pg/mL

          Sample type/volume

          Tissue Homogenate
          50 µL
          Cell Lysate
          50 µL
          Plasma
          50 µL
          Serum
          50 µL

          Hands-on time

          1 hr 20 min

          Time-to-result

          2 hr 30 min

          Homogenous (no wash)

          No

          Interassay CV

          <10%

          Intraassay CV

          <10%

          Instrument

          Absorbance Microplate Reader

          Product size

          96 Tests

          Contents

          Pre-coated 96 well plate, Standard, Biotinylated Detection Antibody, HRP Conjugate, Standard & Sample Diluent, Biotinylated Detection Antibody Diluent, HRP Conjugate Diluent, Wash Buffer, TMB Substrate, Stop Solution, Plate Sealer

          Shipping conditions

          Wet ice

          Storage

          Refer to product documentation for component specific storage temperature.

          Protein name

          AP36

          Species (tested)

          Human

          Species (reported)

          Human

          Assay kit format

          Competitive ELISA

          Detector antibody conjugate

          Biotin

          Label or dye

          HRP

          About This Kit

          The Human Apelin 36 (AP36) ELISA quantitates AP36 in serum, plasma and other biological fluids.

          Principle of the method

          The Competitive Alpha Melanocyte Stimulating Hormone (aMSH) ELISA research use only kit is designed to quantitatively measure aMSH in humans. An aMSH standard is provided to generate a standard curve for the assay and all samples are read off a user generated standard curve. Standards or diluted samples are pipetted into a coated microtiter plate and Biotinylated Detection Ab specific to Human aMSH is added. Excess conjugate and unbound sample or standard are washed from the plate, and Avidin conjugated to Horseradish Peroxidase (HRP) is added to each well and incubated. Then a TMB substrate solution is added to each well. The enzyme substrate reaction is terminated by the addition of stop solution and the color change is measured on a microplate reader. The concentration of Human aMSH in the samples is then determined by comparing the OD of the samples to the standard curve.

          Rigorous validation:

          Each manufactured lot of this ELISA kit is quality tested for criteria such as sensitivity, specificity, precision, and lot-to-lot consistency. See manual for more information on validation.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Target information

          Apelin-36 is a peptide hormone that regulates cardiovascular function, fluid balance, and metabolism. It acts as a ligand for the apelin receptor and has vasodilatory effects, influences fluid balance, and potentially affects energy metabolism. It is produced by various tissues and consists of 36 amino acids (ARVYIHPNSYCFGGHLMDRFRNPTYLPLGCVRF-NH2)

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases : Apelin 36, apelin-36

          Recommended Products

          IL-6 Human Matched Antibody Pair

          Because you are interested in IL-6 Human ELISA Kit.

          SIZE

          10 x 96 tests

          PRICE

          USD 400.00

          Cat # CHC1263

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ immunoassay doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Responsibility Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          México flag icon
          México

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-n9r8p:80/100.66.76.150:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline