Hamburger Menu Button
Thermo Fisher Scientific Logo
Iniciar sesión
¿No tiene una cuenta? Crear una cuenta
  • Productos
    • Consumibles de laboratorio
    • Equipos de laboratorio
    • Instrumentos de Laboratorio
    • Clínica y Diagnóstico
    • Cromatografía
    • Espectrometría de Masas
    • Cultivo Celular
    • Análisis Celular
    • Anticuerpos
    • Ver todas las categorías de producto
  • Aplicaciones
    • Cultivo celular y transfección
    • Citometría de flujo
    • Investigación sobre el cáncer
    • Cromatografía
    • Secuenciación
    • PCR
    • Soluciones para laboratorio
    • Diagnóstico de alergias
    • Ver todas las aplicaciones y técnicas
  • Servicios
    • Servicios Personalizados
    • Servicios de Capacitación
    • Informática para laboratorios de ámbito empresarial
    • Servicios financieros y de arrendamiento
    • Servicios 360° de CDMO y CRO
    • Servicios de CDMO
    • Servicios de CRO
    • Inspección de seguridad alimentaria Servicios
    • Ver todos los servicios
  • Ayuda y Soporte
    • Crear una nueva cuenta
    • Cómo hacer el pedido
    • Póngase en contacto con nosotros
    • Cambio de ubicación
    • Ver toda la ayuda y soporte técnico
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • A quiénes brindamos nuestros servicios
    • Industria biotecnológica
    • Sector biofarmacéutico
    • CDMO
    • Diagnósticos de laboratorio
    • Ciencias aplicadas e industriales
  • Ofertas especiales
  • Contáctenos
  • Orden Rápida
  • Documentos y certificados
Thermo Fisher Scientific Logo

Search

Buscar
Search button
          • Contáctenos
          • Orden Rápida
          • Iniciar sesión
            Iniciar sesión
            ¿No tiene una cuenta? Crear una cuenta
            • Cuenta
            • Estatus del pedido
            • Productos personalizados y proyectos​
          • ELISA Kits ›
          • by Target

          AP36 ELISA Kits

          ELISA kits are commonly used to measure soluble biomarkers across a variety of research areas. ELISA kits for Human AP36 can be quantified in various samples, including cell lysate, plasma, serum, tissue homogenate.

          Invitrogen ELISA kits exist in two formats: Uncoated and Coated....
          ELISA kits are commonly used to measure soluble biomarkers across a variety of research areas. ELISA kits for Human AP36 can be quantified in various samples, including cell lysate, plasma, serum, tissue homogenate.

          Invitrogen ELISA kits exist in two formats: Uncoated and Coated....
          ELISA kits are commonly used to measure soluble biomarkers across a variety of research areas. ELISA kits for Human AP36 can be quantified in various samples, including cell lysate, plasma, serum, tissue homogenate.

          Invitrogen ELISA kits exist in two formats: Uncoated and Coated. Uncoated ELISA kits include all the necessary reagents to coat your own plates and run your assay with maximum flexibility. Coated ELISA kits...
          ELISA kits are commonly used to measure soluble biomarkers across a variety of research areas. ELISA kits for Human AP36 can be quantified in various samples, including cell lysate, plasma, serum, tissue homogenate.

          Invitrogen ELISA kits exist in two formats: Uncoated and Coated. Uncoated ELISA kits include all the necessary reagents to coat your own plates and run your assay with maximum flexibility. Coated ELISA kits are ready-to-use and quality tested for sensitivity, specificity, precision and lot-to-lot consistency.

          Target Information

          Apelin-36 is a peptide hormone that regulates cardiovascular function, fluid balance, and metabolism. It acts as a ligand for the apelin receptor and has vasodilatory effects, influences fluid balance, and potentially affects energy metabolism. It is produced by various tissues and consists of 36 amino acids (ARVYIHPNSYCFGGHLMDRFRNPTYLPLGCVRF-NH2)

          Synonyms

          Apelin 36; apelin-36

          View more
          View less
          Filters
          Filters
          Filters
          Show Less
          +-2
          Clear All
          1 result
          1 result
          Assay Range
          Sample Volume
          Precio
          Compare
          Invitrogen
          Human AP36 Competitive ELISA Kit
          Invitrogen
          Human AP36 Competitive ELISA Kit
          Sensitivity 28.13 pg/mL
          Assay Range 46.88-3,000 pg/mL
          Sample Volume
          Tissue Homogenate
          50 µL
          Cell Lysate
          50 µL
          Plasma
          50 µL
          Time To Result
          2 hr 30 min
          (1 hr 20 min hands-on)
          Precio
          Oferta especial:
          Precio exclusivo en nuestra web
          Online offer:
          Cat # EEL169

          96 Tests

          Not finding what youre looking for? Create Your Own ELISA
          Select Antibodies for your kit

          Select Antibodies for your kit

          Find the exact antibody for your Elisa kit.

          Shop for Antibodies
          Custom Assay Services

          Custom Assay Services

          We provide assay development of your specific protein target.

          Request a quote
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ immunoassay doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Pedidos Plus Icon Minus Icon
          • Estatus del pedido
          • Ayuda para pedidos
          • Orden Rápida
          • Supply Center
          • eProcurement
          Soporte Plus Icon Minus Icon
          • Ayuda y soporte
          • Entre en Contacto
          • Centros de asistencia técnica
          • Consultar documentos y certificados
          • Informar de un problema en la web
          Recursos Plus Icon Minus Icon
          • Centros de aprendizaje
          • Promociones
          • Eventos & Webinars
          • Medios Sociales
          Acerca de Thermo Fisher Plus Icon Minus Icon
          • Acerca de nosotros Acerca de nosotros
          • Empleo Empleo
          • Inversores Inversores
          • Noticias Noticias
          • Responsabilidad social Responsabilidad social
          • Marcas comerciales
          • Políticas y avisos
          Nuestro Portafolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          México flag icon
          México

          Your items have has been added!


          Host server : magellan-search-green-7b6576f7bc-t4kr2:80/100.66.77.141:80.
          git-commit: 6d309ebe7a31b2ceadeb87f43b473eebab110cf3
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.46.0-2026.03.11-1.0