Search
Invitrogen
Human ERO1L (aa 267-376) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-89563
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
LLQETWLEKKWGHNITEFQQRFDGILTEGEGPRRLKNLYFLYLIELRALSKVLPFFERPDFQLFTGNKIQDEENKMLLLEILHEIKSFPLHFDENSFFAGDKKEAHKLKE
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82929. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
ERO1L (endoplasmic oxidoreductin-1-like protein) is localized in ER membrane as peripheral membrane protein on the lumenal side. Its association with ERP44 is essential for its retention in the ER and is unique in coupling oxygen reduction to de novo disulfides formation. The ERO1L enzyme is broadly distributed at low levels in several tissues with highest levels in the upper digestive tract and is stimulated by hypoxia via HIF-signaling. ERO1L generally exists as monomer, but has the ability to function as monomer or homodimer and interacts with PDILT. After translation, ERO1L gets n-glycosylated and the disulfide bonds constitute the redox-active center whereby the Cys-94/Cys-99 disulfide bond accepts an electron from P4HB followed by funneling the same to the active site disulfide Cys-394/Cys-397. ERO1L acts by oxidizing directly to P4HB/PDI isomerase through direct disulfide exchange and associates with ERP44. ERO1L is implicated in immunoglobulin folding, oxidative stress, release of unfolded cholera toxin from reduced P4HB/PDI upon Vibrio cholerae infection, and plays a key role in ER stress-induced CHOP-dependent apoptosis through inositol 1,4,5-trisphosphate receptor IP3R1 activation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Endoplasmic oxidoreductin-1-like protein; Endoplasmic reticulum oxidoreductase alpha; ero1; ERO1 homolog; ERO1-L; ERO1-like protein alpha; Oxidoreductin-1-L-alpha; unnamed protein product
Gene Aliases: ERO1-alpha; ERO1-L; ERO1-L-alpha; ERO1A; Ero1alpha; ERO1L; ERO1LA; UNQ434/PRO865
UniProt ID: (Human) Q96HE7
Entrez Gene ID: (Human) 30001
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support