Search
Invitrogen
Human DGKD (aa 979-1109) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-104581
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
TQMDQFGQAAGVLIHSIREIAQSHRDMEQELAHAVNASSKSMDRVYGKPRTTEGLNCSFVLEMVNNFRALRSETELLLSGKMALQLDPPQKEQLGSALAEMDRQLRRLADTPWLCQSAEPGDEESVMLDLA
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110941. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Diacylglycerol kinases (DGKs) phosphorylate diacylglycerol (DAG) to produce phosphatidic acid. DAG and phosphatidic acid are lipids that act as second messengers in signaling cascades. DGK-alpha influences cell activation and secretion of lethal exosomes, which in turn control cell death. DGK-beta is abundant in restricted brain regions such as the caudate putamen and olfactory tubercle. DGK-gamma encodes full-length and truncated transcripts that are present in a range of human tissues, with greatest expression observed in retina. DGK-delta is most abundant in skeletal muscle. DGK-epsilon shows specificity for arachidonylcontaining diacylglycerol and is expressed predominantly in testis. DGK-theta is most abundant in the cerebellum and hippocampus. DGK-iota is present in brain and retina as a predominant transcript of more than 12 kb, including a long 3-prime untranslated region, with additional low abundance transcripts of 9.5 and 7.5 kb. DGK-eta is closely related to DGK-delta. DGK-zeta is most abundant in brain and muscle. DGKs have structural motifs that play regulatory roles, and these motifs form the basis for dividing the DGKs into five subtypes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 130 kDa diacylglycerol kinase; DAG kinase delta; DGK delta; DGK-delta; Diacylglycerol kinase delta; diacylglycerol kinase, delta 130kDa; Diglyceride kinase; Diglyceride kinase delta; EC 2.7.1.107; FLJ26930; unnamed protein product
Gene Aliases: DGK-delta; DGKD; dgkd-2; DGKdelta; KIAA0145
UniProt ID: (Human) Q16760
Entrez Gene ID: (Human) 8527
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support