Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human FNTA (aa 58-125) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-101897
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
LDSPSYVLYRHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADI
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53858. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
FNTA (Farnesyltransferase, CAAX box; alphaCAAX farnesyltransferase alpha subunit, FPTA, FTase-alpha, GGTase-I-alpha, Protein farnesyl transferase/ geranyl geranyl transferase type I alpha subunit(PGGT1A), Ras proteins prenyl transferase alpha, Type I protein geranyl-geranyl transferase alpha subunit) is located locus 8p11 (human). Prenylation is a common intracellular posttranslational protein modification catalyzed by prenyltransferases. The best characterized among these prenyltransferases is the CAAX farnesyl transferase (2. 5. 1. 21), which is alpha-beta heterodimeric enzyme. It catalyzes the attachment of a farnesyl group from farnesyl phosphate to cysteine residues at the fourth position from the C terminus of proteins that end in the CAAX box. FNTA or the alpha subunit of farnesyl transferase is shared by the geranyl-geranyl protein transferases. Apart from transfer of farnesyl and geranyl groups to proteins, FNTA has been proposed to regulate intracellular signaling pathways involving p21ras. Reports have shown that FNTA interacts with TGF-beta and activin-type I receptors.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CAAX farnesyltransferase subunit alpha; farnesyl-protein transferase alpha-subunit; FTase-alpha; GGTase-I-alpha; Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; protein prenyltransferase alpha subunit repeat containing 2; Ras proteins prenyltransferase subunit alpha; type I protein geranyl-geranyltransferase alpha subunit; Type I protein geranyl-geranyltransferase subunit alpha
Gene Aliases: FNTA; FPTA; PGGT1A; PTAR2
UniProt ID: (Human) P49354
Entrez Gene ID: (Human) 2339
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support