Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human GASP2 (aa 47-107) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-102961
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
STCERECSRDQDCAAAEKCCINVCGLHSCVAARFPGSPAAPTTAASCEGFVCPQQGSDCDI
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60654. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The GASP2 gene encodes for a protein known as G protein-coupled receptor-associated sorting protein 2. GASP2 is involved in the regulation of G protein-coupled receptors (GPCRs), which are crucial for transmitting signals from the external environment to the inside of a cell. This protein plays a key role in the intracellular trafficking and sorting of GPCRs, affecting their recycling and degradation pathways, which are critical for receptor resensitization and downregulation. GASP2 assists in marking GPCRs for degradation post endocytosis, thereby influencing receptor availability on the cell surface and modulating cellular responsiveness to ligands. Dysregulation of GASP2 expression or function can impact GPCR signaling pathways, potentially affecting various physiological processes and contributing to disease states where GPCR signaling is altered, such as in certain neurological disorders and cancers. The role of GASP2 in GPCR regulation makes it a point of interest for therapeutic targeting to modulate GPCR-related signaling pathways for clinical benefits in diverse diseases.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: GASP-2; Growth and differentiation factor-associated serum protein 2; hGASP-2; WAP four-disulfide core domain 20A; WAP, follistatin, immunoglobulin, Kunitz and NTR domain-containing protein; WAP, FS, Ig, KU, and NTR-containing protein; WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1
Gene Aliases: C16orf12; GASP2; PSEC0040; RJD2; WFDC20A; WFIKKN; WFIKKN1
UniProt ID: (Human) Q96NZ8
Entrez Gene ID: (Human) 117166
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support