Hamburger Menu Button
Thermo Fisher Scientific Logo
Se connecter
Vous n’avez pas de compte? Créer votre compte
  • Produits
    • Anticorps
    • Oligos, amorces, sondes et gènes
    • Réactions PCR en temps réel Taqman
    • Milieux de culture cellulaire
    • Produits chimiques
    • Colonnes et cartouches de chromatographie
    • Équipement de laboratoire
    • Consommables en plastique et fournitures de laboratoire
    • Microplaques
    • Produits plus écologiques
    • Afficher toutes les catégories de produits
  • Applications
    • Bioprocédés
    • Culture cellulaire et transfection
    • Thérapie cellulaire et génétique
    • Chromatographie
    • Tests moléculaires
    • Solutions numériques
    • Extraction et analyse d’ADN et d’ARN
    • Spectroscopie, analyse élémentaire et isotopique
    • Voir toutes les applications et techniques
  • Services
    • Services CDMO et CRO à 360°
    • Services CDMO
    • Services CRO
    • Services personnalisés
    • Services financiers et leasing
    • Services pour les instruments
    • Informatique de laboratoire
    • Offres commerciales et OEM
    • Services de formation
    • Unity Lab Services
    • Voir tous les services
  • Aide et assistance
    • S’inscrire et créer un compte
    • Comment commander
    • Assistance instruments
    • Centres d’assistance technique
    • Centres d’apprentissage
    • Consultez toutes les rubriques d'aide et d'assistance
  • Populaire
    • TaqMan Real-Time PCR Assays
      Reaction PCR en temps réel TaqMan
    • Antibodies
      Anticorps
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt - Synthèse Gène
    • Cell Culture Plastics
      Plastiques culture cellulaire
  • Nos clients
    • Biotechnologie
    • Industrie biopharmaceutique
    • CDMO
    • Diagnostics de laboratoire
    • Sciences industrielles et appliquées associées
  • Promotions
  • Contactez-nous
  • Commande rapide
  • Suivi et statut de la commande
  • Documents et certificats
Thermo Fisher Scientific Logo

Search

Rechercher
Search button
          • Statut des commandes
          • Commande rapide
          • Promos
          • Se connecter
            Se connecter
            Vous n’avez pas de compte? Créer votre compte
            • Mon compte
            • Commandes
            • Connect: lab, données, apps
            • Produits personnalisés et projets
            • Services Central
          • Proteins & Peptides ›
          • HPDL Proteins

          Invitrogen

          Human HPDL (aa 192-283) Control Fragment Recombinant Protein

          View all (2) HPDL proteins

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Tech Support
          Datasheet
          Certificates
          Tech Support
          Datasheet
          Certificates
          Tech Support

          Cite Human HPDL (aa 192-283) Control Fragment Recombinant Protein

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}

          Product Details

          RP-94520

          Applications
          Tested Dilution
          Publications

          Neutralization (Neu)

          Assay-dependent
          -
          Product Specifications

          Species

          Human

          Expression System

          E. coli

          Amino acid sequence

          SPGEDPELGLEMTAGFGLGGLRLTALQAQPGSIVPTLVLAESLPGATTRQDQVEQFLARHKGPGLQHVGLYTPNIVEATEGVATAGGQFLAP

          Tag

          His-ABP-tag

          Class

          Recombinant

          Type

          Protein

          Purity

          >80% by SDS-PAGE and Coomassie blue staining

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Liquid

          Concentration

          ≥5.0 mg/mL

          Purification

          purified

          Storage buffer

          PBS/1M urea, pH 7.4

          Contains

          no preservative

          Storage conditions

          -20°C, Avoid Freeze/Thaw Cycles

          Shipping conditions

          Wet ice

          Product Specific Information

          Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%).

          This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56898. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

          Target Information

          May have dioxygenase activity.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: 4-hydroxyphenylpyruvate dioxygenase-like protein; Glyoxalase domain-containing protein 1; HPD-like protein; RP4-534D1.1; unnamed protein product

          View more View less

          Gene Aliases: 4-HPPD-L; GLOXD1; HPDL; NEDSWMA; SPG83

          View more View less

          UniProt ID: (Human) Q96IR7

          View more View less

          Entrez Gene ID: (Human) 84842

          View more View less

          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Commander Plus Icon Minus Icon
          • Statut des commandes
          • Assistance commandes
          • Commande rapide
          • Centre d’approvisionnement
          • Approvisionnement en ligne
          Assistance Plus Icon Minus Icon
          • Aide et assistance
          • Contactez-nous
          • Centres d’assistance technique
          • Documents et certificats
          • Signaler un problème sur le site
          Ressources Plus Icon Minus Icon
          • Centres d’apprentissage
          • Promotions
          • Événements et séminaires en ligne
          • Réseaux sociaux
          À propos de Thermo Fisher Plus Icon Minus Icon
          • À propos de nous À propos de nous
          • Emplois Emplois
          • Investisseurs Investisseurs
          • Actualités Actualités
          • Responsabilité sociale Responsabilité sociale
          • Marques commerciales
          • Politiques et notices d’information
          Notre portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          France flag icon
          France

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-n9r8p:80/100.66.76.150:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline