Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human SOX6 (aa 299-404) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-102022
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
TYKPGDNYPVQFIPSTMAAAAASGLSPLQLQQLYAAQLASMQVSPGAKMPSTPQPPNTAGTVSPTGIKNEKRGTSPVTQVKDEAAAQPLNLSSRPKTAEPVKSPTS
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81994. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The SOX6 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors, which are known to play vital roles in the regulation of developmental processes and cell fate determination. SOX6, along with its close relatives SOX5 and SOX13, constitutes the SOXD subfamily, which is involved in the regulation of the development of the central nervous system, skeletal system, and cartilage. It functions by binding to specific DNA sequences and modulating the expression of target genes necessary for these developmental processes. SOX6 has been implicated in various functions, such as promoting cartilage formation by acting in conjunction with SOX9 to drive chondrogenesis. In adult neural stem cells, SOX6 is essential for the activation of radial glial-like cells and the generation of new neurons, emphasizing its role in both embryonic development and adult tissue maintenance. The dysregulation of SOX6 has been associated with developmental disorders and its potential involvement in pathologies like cancer, where it influences cell differentiation and proliferation pathways.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: SRY (sex determining region Y)-box 6; SRY box 6; SRY-box containing gene 6; Transcription factor SOX-6
Gene Aliases: HSSOX6; SOX6; SOXD
UniProt ID: (Human) Q9H0I8
Entrez Gene ID: (Human) 55553
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support