Search
Invitrogen
PTGER4 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 1
PTGER4 Antibody (PA5-95439) in WB
Western blot analysis of PTGER4 in Lane 1: SW620 whole cell lysates, Lane 2: MCF-7 whole cell lysates. Electrophoresis was performed with 5-20% SDS-PAGE gel (70V, Stacking gel; 90V Resolving gel, Time: 2-3 hours), transferred to a nitrocellulose membrane and blocked using 5% Non-fat Milk/TBS (1.5 hrs at room temperature). Samples were incubated with PTGER4 polyclonal antibody (Product # PA5-95439) using a 0.5 µg/mL dilution, followed by a goat anti-rabbit IgG-HRP at a dilution of 1:10,000, and developed with enhanced chemiluminescence (ECL... View More
Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.
Product Details
PA5-95439
Product Specifications
Species Reactivity
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human PTGER4 (311-345aa DLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIK).
Conjugate
Unconjugated
Unconjugated
Unconjugated
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: SW620 whole cell, MCF-7 whole cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
The protein encoded by this gene is a member of the G-protein coupled receptor family. This protein is one of four receptors identified for prostaglandin E2. This receptor can activate T-cell factor signaling. It has been shown to mediate PGE2 induced expression of early growth response 1, regulate the level and stability of cyclooxygenase-2 mRNA, and lead to the phosphorylation of glycogen synthase kinase-3. Knockout studies in mice suggest that this receptor may be involved in the neonatal adaptation of circulatory system, osteoporosis, as well as initiation of skin immune responses.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: EP1; G-protein coupled receptor; PTGER4; MGC126583; PGE receptor, EP4 subtype; PGE2 receptor EP4 subtype; prostaglandin E receptor 4 (subtype EP4); prostanoid EP4 receptor
Gene Aliases: EP4; EP4R
UniProt ID: (Human) P35408
Entrez Gene ID: (Human) 5734
negative regulation of cytokine production
positive regulation of cytokine production
inflammatory response
immune response
G-protein coupled receptor signaling pathway
adenylate cyclase-modulating G-protein coupled receptor signaling pathway
adenylate cyclase-activating G-protein coupled receptor signaling pathway
adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway
positive regulation of cytosolic calcium ion concentration
JNK cascade
response to mechanical stimulus
negative regulation of integrin activation
response to lipid
response to prostaglandin E
T-helper cell differentiation
negative regulation of inflammatory response
positive regulation of inflammatory response
regulation of stress fiber assembly
bone development
ERK1 and ERK2 cascade
cellular response to mechanical stimulus
cellular response to prostaglandin E stimulus
negative regulation of eosinophil extravasation
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support