Search
Invitrogen
Human ABHD13 (aa 235-320) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-102618
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
MRYLPLWCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPDGTHNDTWQCQGYFTALEQFIKEVVK
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56943. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The α/β hydrolase superfamily comprise diverse members that are involved in important biochemical processes and related to various diseases. They have unrelated sequences, various substrates, and different kinds of catalytic activities, yet they share the same canonical α/β hydrolase fold, which consists of an eightstranded parallel α/β structure. They are also characterized by a catalytic triad composed of a histidine, an acid and a nucleophile. Members of this superfamily are often drug targets for treating diseases, such as diabetes, Alzheimer's disease, obesity and blood clotting disorders. The Ab hydrolase domain containing (ABHD) gene subfamily is comprised of 15 mostly uncharacterized members. Most of which utilize a serine nucleophile to form the G-X-S-X-G nucleophile elbow. ABHD1 plays a role in metabolizing smoking xenobiotics. ABHD2 participates in the development of atherosclerosis. ABHD4 is involved in an alternative synthesis pathway of NAE. Mutations in ABHD5 contribute to Chanarin-Dorfman syndrome. ABDH6 may play a role in nervous system metabolism and signaling. ABHD13 is a 337 amino acid single-pass membrane protein that belongs to the ABHD family.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Abhydrolase domain-containing protein 13; Alpha/beta hydrolase domain-containing protein 13; Protein ABHD13; RP11-153I24.2; unnamed protein product
Gene Aliases: ABHD13; bA153I24.2; BEM46L1; C13orf6
UniProt ID: (Human) Q7L211
Entrez Gene ID: (Human) 84945
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support