Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign In
Don't have an account ? Create Account
  • Applications
    • Real-Time PCR
    • Oligos, Primers, Probes and Genes
    • Cloning
    • Protein Biology
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Cell Analysis
    • Mass Spectrometry
    • Chromatography
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Online Order
    • Custom Primers & TaqMan Probes
    • miRNA Mimics & Inhibitors
    • Stealth RNAi / siRNA
    • Silencer Select siRNAs
    • Custom DNA Oligos
    • GeneArt Services
    • GeneArt Strings DNA Fragments
    • TrueGuide CRISPR gRNA
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • See all online orderable products
  • Services
    • Custom Services
    • Instrument Qualification Services
    • Technical Services
    • Pipette Services
    • Sample Request
    • Instrument Maintenance Services
    • Repairs and Relocation Services
    • OEM and Licensing Services
    • Events, Seminars, Training
    • Unity Lab Services
    • See all services
  • Support
    • Catalogs
    • Application Notes
    • Safety Data Sheets
    • Legal and Regulatory
    • Certificates of Analysis Search
    • Nunc/Nalgene Product Certificates
    • e-learning
    • FAQs
    • Learning Centers
    • Technical Support Centers
    • See all help and support topics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Contact Us
          • Quick Order
          • Sign In
            Sign In
            Don't have an account ? Create Account
            • Connect Your Lab
            • Custom Products & Projects
            • Instrument Management
          • Primary Antibodies ›
          • AP2M1 Antibodies

          Invitrogen

          AP2M1 Polyclonal Antibody

          View all (29) AP2M1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite AP2M1 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (1)
          AP2M1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          AP2M1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 1

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          AP2M1 Antibody (PA5-95390) in WB

          Western blot analysis of AP2M1 in, Lane 1: human U2OS whole cell lysates, Lane 2: human MCF-7 whole cell lysates, Lane 3: rat kidney tissue lysates, . Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50 µg of sample under reducing conditions. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. The membrane was blocked with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane wa... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          AP2M1 Antibody in Western Blot (WB)
          AP2M1 Polyclonal Antibody

          Product Details

          PA5-95390

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human AP2M1 (399-435aa LKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807193

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human U2OS whole cell, human MCF-7 whole cell, rat kidney tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          The heterotetrameric coat assembly protein complex, also known as the adaptor-related protein complex 2 (AP-2), belongs to the adaptor complexes medium subunits family. The mu 1 subunit of the AP-2 complex (AP2M1) is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. AP2M1 has also been shown to associate with the HIV-1 protein Nef, suggesting that Nef may use AP-2 complex to enhance the rate of endocytosis of both CD4 and class I MHC. AP2M1 may also play an important role in regulating the intracellular trafficking and function of cytotoxic T-lymphocyte associated (CTLA)-4 protein. At least two isoforms of AP2M1 are known to exist.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: adapter-related protein complex 2 mu subunit; adapter-related protein complex 2 subunit mu; Adaptin-mu2; Adaptor protein complex AP-2 subunit mu; adaptor related protein complex 2 mu 1 subunit; Adaptor-related protein complex 2 subunit mu; AP-2 complex subunit mu; AP-2 mu 2 chain; AP-2 mu chain; clathrin adaptor complex AP2, mu subunit; clathrin assembly protein complex 2 medium chain; Clathrin assembly protein complex 2 mu medium chain; clathrin coat adaptor protein AP50; Clathrin coat assembly protein AP50; Clathrin coat-associated protein AP50; clathrin-associated/assembly/adaptor protein, medium 1; coat assembly protein complex 50 kD; HA2 50 kDA subunit; KIAA0109; Mu2-adaptin; Plasma membrane adaptor AP-2 50 kDa protein; plasma membrane adaptor AP-2 50kDA protein; unnamed protein product

          View more View less

          Gene Aliases: AP2M1; AP50; CLAPM1; KIAA0109; MRD60; mu2

          View more View less

          UniProt ID: (Human) Q96CW1, (Rat) P84092, (Mouse) P84091

          View more View less

          Entrez Gene ID: (Human) 1173, (Rat) 116563, (Mouse) 11773

          View more View less

          Function(s)
          signal sequence binding protein binding lipid binding clathrin adaptor activity ion channel binding low-density lipoprotein particle receptor binding disordered domain specific binding membrane traffic protein
          Process(es)
          positive regulation of receptor internalization intracellular protein transport endocytosis membrane budding protein transport vesicle-mediated transport receptor internalization synaptic vesicle endocytosis protein-containing complex assembly clathrin-mediated endocytosis regulation of vesicle size postsynaptic neurotransmitter receptor internalization vesicle-mediated transport in synapse positive regulation of synaptic vesicle endocytosis negative regulation of protein localization to plasma membrane
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Online Orderable Products
          • Privacy Policy for Online Ordering
          • Act on Specified Commercial Transactions
          • About Returns
          • About Displayed Prices
          • About Shipping Fees
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Study information disclosure
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Seminars
          • Blog
          About Thermo Fisher Plus Icon Minus Icon
          • Corporate Information
          • Social Responsibility (CSR)
          • Enhancing Customer Experience
          • Careers Careers
          • News
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Japan flag icon
          Japan

          Your items have has been added!


          Host server : magellan-search-green-6b469b8bb7-kg5vd:80/100.66.78.64:80.
          git-commit: a334af76dff23450325448aedefe62379591458a
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.48.1-2026.04.16-1.0