Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案
          • Primary Antibodies ›
          • BAX Antibodies

          Invitrogen

          Bax Polyclonal Antibody

          1 Published Figure
          1 Reference
          View all (54) BAX antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite Bax Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (1)
          • Published Figures (1)
          Bax Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          Bax Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 2

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          Bax Antibody (PA5-78857) in WB

          Western blot was performed using Anti-Bax Polyclonal Antibody(Product # PA5-78857) and a 19 kDa band corresponding to Bax was observed across cell lines and tissues tested. Whole Cell Extract-WCL (30 µg µg lysate) of MCF7 (Lane 1),,MCF7 treated with etoposide (50 µM, 16Hrs)(Lane 2), A549 (Lane 3),A549 treated with etoposide (50 µM, 16Hrs) (Lane 4) were electrophoresed using NuPAGE™ 4-12% Bis-Tris Protein Gel (Product # NP0322BOX). Resolved proteins were then transferred onto a Nitrocellulose membrane (Product # LC2002) by iBlot® 2 Dry Blot... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          Bax Antibody in Western Blot (WB)
          Bax Antibody in Immunohistochemistry (IHC)
          Bax Polyclonal Antibody

          Product Details

          PA5-78857

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          - -

          Immunohistochemistry (IHC)

          -
          View 1 publication 1 publication

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Published species

          Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2745973

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: rat thymus tissue, mouse thymus tissue, HEPA1-6 whole cell, HELA whole cell, MCF-7 whole cell. IHC: human lung cancer tissue, rat intestine tissue, human intetsinal cancer tissue, mouse intestine tissue. Flow: A549 cell.

          Target Information

          BAX is a members of the Bcl-2 Family and plays an important role in regulation of apoptosis. Whereas Bcl-2 is commonly regarded as an anti-apoptotic protein, BAX is considered to have a pro-apoptotic function. Regulation of apoptosis is supposed to involve both homo- and heterodimerization of different isoforms of BAX and Bcl-2. The Bax gene encodes different isoforms including Bax alpha (21 kDa) and Bax beta (24 kDa), whereas both isoforms contain the BH1, BH2 and BH3 domains, Bax beta has a unique carboxyl terminus and does not contain a hydrophobic transmembrane domain. Bcl-2 is also expressed in different Isoforms. Bcl-2 beta differs in the 3' UTR and coding region compared to variant alpha. Bcl-2 beta is shorter (22 kDa) and has a distinct C-terminus compared to Bcl-2 alpha (26 kDa). BAX is a member of the BCL-2 family of proteins, which function as regulators of apoptosis. Overexpression of BAX functions to promote cell death. BAX can form homodimers and is also able to heterodimerize with other BCL-2 related proteins.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: alternatively spliced; Apoptosis regulator BAX; Bax zeta; Baxdelta2(G7); Baxdelta2(G8)-RFS protein; Baxdelta2G9; Baxdelta2G9omega; Baxdelta2omega; Bcl-2-like protein 4; BCL2 associated X protein; BCL2-associated X protein omega; Bcl2-L-4; unnamed protein product

          View more View less

          Gene Aliases: BAX; BCL2L4

          View more View less

          UniProt ID: (Human) Q07812, (Mouse) Q07813

          View more View less

          Entrez Gene ID: (Human) 581, (Rat) 24887, (Mouse) 12028

          View more View less

          Function(s)
          protein binding lipid binding channel activity Hsp70 protein binding identical protein binding protein homodimerization activity protein heterodimerization activity chaperone binding BH3 domain binding heat shock protein binding protein complex binding BH domain binding
          Process(es)
          ovarian follicle development neuron migration leukocyte homeostasis T cell homeostatic proliferation B cell homeostasis B cell apoptotic process kidney development release of cytochrome c from mitochondria blood vessel remodeling myeloid cell homeostasis B cell negative selection B cell homeostatic proliferation positive regulation of B cell apoptotic process glycosphingolipid metabolic process regulation of nitrogen utilization apoptotic process cellular response to DNA damage stimulus mitochondrion organization germ cell development spermatogenesis nervous system development sex differentiation mitochondrial fusion cell proliferation negative regulation of cell proliferation male gonad development extrinsic apoptotic signaling pathway via death domain receptors intrinsic apoptotic signaling pathway in response to DNA damage apoptotic mitochondrial changes fertilization response to wounding response to toxic substance response to salt stress post-embryonic development response to ionizing radiation establishment or maintenance of transmembrane electrochemical gradient response to gamma radiation positive regulation of calcium ion transport into cytosol negative regulation of mitochondrial membrane potential hypothalamus development cerebral cortex development positive regulation of protein complex assembly negative regulation of protein binding endoplasmic reticulum calcium ion homeostasis negative regulation of endoplasmic reticulum calcium ion concentration release of matrix enzymes from mitochondria cellular response to stress regulation of mammary gland epithelial cell proliferation cellular response to unfolded protein cellular response to UV limb morphogenesis ectopic germ cell programmed cell death odontogenesis of dentin-containing tooth regulation of apoptotic process positive regulation of apoptotic process regulation of neuron apoptotic process negative regulation of neuron apoptotic process positive regulation of neuron apoptotic process mitochondrial fragmentation involved in apoptotic process development of secondary sexual characteristics retinal cell programmed cell death positive regulation of developmental pigmentation negative regulation of fibroblast proliferation spermatid differentiation post-embryonic camera-type eye morphogenesis response to axon injury homeostasis of number of cells homeostasis of number of cells within a tissue epithelial cell proliferation positive regulation of developmental process protein insertion into mitochondrial membrane release of sequestered calcium ion into cytosol positive regulation of release of sequestered calcium ion into cytosol neuron apoptotic process establishment of localization in cell regulation of cell cycle regulation of mitochondrial membrane potential Sertoli cell proliferation retina development in camera-type eye apoptotic process involved in mammary gland involution positive regulation of apoptotic process involved in mammary gland involution vagina development calcium ion transport into cytosol intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress thymocyte apoptotic process intrinsic apoptotic signaling pathway by p53 class mediator positive regulation of release of cytochrome c from mitochondria motor neuron apoptotic process apoptotic signaling pathway extrinsic apoptotic signaling pathway extrinsic apoptotic signaling pathway in absence of ligand intrinsic apoptotic signaling pathway execution phase of apoptosis fibril organization cellular response to virus regulation of mitochondrial membrane permeability involved in apoptotic process positive regulation of mitochondrial membrane permeability involved in apoptotic process apoptotic process involved in patterning of blood vessels apoptotic process involved in embryonic digit morphogenesis regulation of mitochondrial membrane permeability involved in programmed necrotic cell death positive regulation of apoptotic DNA fragmentation regulation of intracellular signal transduction positive regulation of IRE1-mediated unfolded protein response epithelial cell apoptotic process positive regulation of epithelial cell apoptotic process B cell receptor apoptotic signaling pathway positive regulation of reproductive process positive regulation of motor neuron apoptotic process regulation of apoptotic signaling pathway negative regulation of apoptotic signaling pathway positive regulation of intrinsic apoptotic signaling pathway protein insertion into mitochondrial membrane involved in apoptotic signaling pathway activation of cysteine-type endopeptidase activity involved in apoptotic process obsolete transformed cell apoptotic process inner mitochondrial membrane organization outer mitochondrial membrane organization brain development activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c positive regulation of protein oligomerization negative regulation of peptidyl-serine phosphorylation glial cell apoptotic process response to cocaine response to drug regulation of cysteine-type endopeptidase activity involved in apoptotic process regulation of protein homodimerization activity regulation of protein heterodimerization activity cellular respiration response to copper ion protein oligomerization protein homooligomerization response to corticosterone mitochondrion morphogenesis cellular response to organic substance activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway positive regulation of endoplasmic reticulum unfolded protein response retinal cell apoptotic process positive regulation of extrinsic apoptotic signaling pathway in absence of ligand transmembrane transport
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-hznln:80/100.66.79.29:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline