Search Thermo Fisher Scientific
Search Thermo Fisher Scientific
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD). |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS with 4mg trehalose |
Contains |
0.05mg sodium azide |
Storage conditions |
-20°C |
RRID |
AB_2745973 |
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
BAX is a members of the Bcl-2 Family and plays an important role in regulation of apoptosis. Whereas Bcl-2 is commonly regarded as an anti-apoptotic protein, BAX is considered to have a pro-apoptotic function. Regulation of apoptosis is supposed to involve both homo- and heterodimerization of different isoforms of BAX and Bcl-2. The Bax gene encodes different isoforms including Bax alpha (21 kDa) and Bax beta (24 kDa), whereas both isoforms contain the BH1, BH2 and BH3 domains, Bax beta has a unique carboxyl terminus and does not contain a hydrophobic transmembrane domain. Bcl-2 is also expressed in different Isoforms. Bcl-2 beta differs in the 3' UTR and coding region compared to variant alpha. Bcl-2 beta is shorter (22 kDa) and has a distinct C-terminus compared to Bcl-2 alpha (26 kDa). BAX is a member of the BCL-2 family of proteins, which function as regulators of apoptosis. Overexpression of BAX functions to promote cell death. BAX can form homodimers and is also able to heterodimerize with other BCL-2 related proteins.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: Apoptosis regulator BAX; Bax zeta; Baxdelta2G9; Baxdelta2G9omega; Baxdelta2omega; Bcl-2-like protein 4; BCL2 associated X protein; BCL2-associated X protein omega; Bcl2-L-4
Gene Aliases: BAX; BCL2L4
UniProt ID: (Human) Q07812, (Mouse) Q07813
Entrez Gene ID: (Human) 581, (Rat) 24887, (Mouse) 12028
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support