Search
Invitrogen
TIMP3 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 1
TIMP3 Antibody (PA5-95446) in WB
Western blot analysis of TIMP3 in, Lane 1: rat kidney tissue lysates, Lane 2: NIH3T3 whole cell lysates. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50 µg of sample under reducing conditions. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. The membrane was blocked with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with TIMP3 Polyclonal Antibody (Pr... View More
Product Details
PA5-95446
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human TIMP3 (107-141aa RVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHL).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat kidney tissue, NIH3T3 whole cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
Tissue inhibitor of metalloproteinase 3 (TIMP3) is a member of the tissue inhibitor of metalloproteinases gene family. It functions to inhibit the activity of matrix metalloproteinases (MMP) which degrade components of the extracellular matrix. TIMP3 is expressed upon mitogenic stimulation. It binds irreversibly to zinc-dependent MMPs and inactivates them by binding to their catalytic zinc cofactor. Other functions of TIMP3 include nervous system development, tissue regeneration, and visual perception. In humans, the gene encoding TIMP3 is located on chromosome 22.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Metalloproteinase inhibitor 3; MIG-5 protein; Protein MIG-5; TIMP 3; TIMP-3; TIMP3; tissue inhibitor of metalloproteinase 3 (Sorsby fundus dystrophy, pseudoinflammatory); Tissue inhibitor of metalloproteinases 3; tissue inhibitor of metalloproteinases-3; unnamed protein product
Gene Aliases: HSMRK222; K222; K222TA2; SFD; Sun; Timp-3; TIMP3
UniProt ID: (Human) P35625, (Mouse) P39876
Entrez Gene ID: (Human) 7078, (Rat) 25358, (Mouse) 21859
visual perception
response to hormone
negative regulation of extracellular matrix disassembly
response to cytokine
negative regulation of proteolysis
negative regulation of membrane protein ectodomain proteolysis
central nervous system development
aging
response to mechanical stimulus
response to organic substance
negative regulation of endopeptidase activity
response to organic cyclic compound
tissue regeneration
negative regulation of catalytic activity
response to amino acid
response to estrogen
response to folic acid
cellular response to organic substance
negative regulation of peptidase activity
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support