Search
Alomone Labs, LTD
KCNJ1 (Kir1.1) Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 2
KCNJ1 (Kir1.1) Antibody (APC-001-200UL) in IHC
Expression of KCNJ1in rat kidney - Immunohistochemical staining of rat kidney sections using Anti-KCNJ1 (Kir1.1) Antibody (#APC-001), (left).There is strong staining (red) of tubular epithelial cells in distal tubes.Note that no staining is observed in proximal tubules (arrow).Counterstain of cell nuclei appears blue. A negative control is shown (right).
Product Details
APC-001-200UL
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
GST fusion protein with the sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 of rat KCNJ1, Intracellular, C-terminus
Conjugate
Form
Lyophilized
Concentration
0.8 mg/mL
Amount
160 µg
Purification
Antigen affinity chromatography
Storage buffer
PBS, pH 7.4, with 1% BSA
Contains
0.05% sodium azide
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Ambient (domestic); Wet ice (international)
Product Specific Information
Reconstitution: 25 µL, 50 µL or 0.2 mL double distilled water (DDW), depending on the sample size. The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20C. The reconstituted solution can be stored at 4C for up to 1 week. For longer periods, small aliquots should be stored at -20C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).
Target Information
Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. It is activated by internal ATP and probably plays an important role in potassium homeostasis. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Mutations in this gene have been associated with antenatal Bartter syndrome, which is characterized by salt wasting, hypokalemic alkalosis, hypercalciuria, and low blood pressure. Multiple transcript variants encoding different isoforms have been found for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: ATP-regulated potassium channel ROM-K; ATP-sensitive inward rectifier potassium channel 1; Inward rectifier K(+) channel Kir1.1; inwardly rectifying K+ channel; inwardly rectifying potassium channel ROMK-2; K+ channel protein; KAB-1; kir1.1; OTTHUMP00000045938; Potassium channel, inwardly rectifying subfamily J member 1; Potassium inwardly-rectifying channel subfamily J; potassium inwardly-rectifying channel, subfamily J, member 1; potassium voltage-gated channel subfamily J member 1; unnamed protein product
Gene Aliases: Kcnj; KCNJ1; KIR1.1; ROMK; ROMK1; Romk2
UniProt ID: (Human) P48048, (Mouse) O88335
Entrez Gene ID: (Human) 3758, (Mouse) 56379, (Rat) 24521
nucleotide binding
inward rectifier potassium channel activity
potassium channel activity
ATP binding
phosphatidylinositol-4,5-bisphosphate binding
ATP-activated inward rectifier potassium channel activity
voltage-gated ion channel activity
potassium ion binding
peptide binding
ion channel
transporter
kidney development
tissue homeostasis
ion transport
potassium ion transport
post-embryonic development
gene expression
metal ion transport
ion transmembrane transport
regulation of ion transmembrane transport
renal sodium ion absorption
circulatory system development
potassium ion import across plasma membrane
transport
potassium ion import
negative regulation of apoptotic process
cellular response to magnesium ion
potassium ion transmembrane transport
cardiovascular system development
regulation of G-protein activated inward rectifier potassium channel activity
response to potassium ion
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support