Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human RELM beta (aa 27-111) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-98522
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
LDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
2.40 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61896. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Adipose tissue is an energy reserve that is strictly regulated in animals. Adipose cells produce and secrete numerous physiologically important proteins, such as lipoprotein lipase (LPL), leptin, adipocyte complement related protein of 30 kDa (Acrp30), perilipin, and resistin. Resistin, also known as Adipocyte Secreted Factor (ADSF) and FIZZ3, is a cytokine that is specifically secreted by adipocytes. While the function of resistin is not well understood, it appears to have key paracrine roles and has a suggested role in type 2 diabetes. Studies show that in obese, diabetic mice the levels of serum resistin are increased, which has an antagonistic effect on insulin. Additional studies have shown that resistin causes insulin resistance and glucose intolerance in mice. Resistin gene expression requires C/EBP alpha, which is necessary and sufficient for expression. Studies show that the coactivators CBP and p300, which have been shown to display histone acetyltransferase (HAT) activity, abundantly acetylate the histones at the resistin promoter suggesting their role in activating chromatin for resistin transcription. Numerous PPAR gamma and RXR ligands have been shown to downregulate resistin expression in adipocytes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 2; Colon and small intestine-specific cysteine-rich protein; Colon carcinoma-related gene protein; cysteine-rich secreted A12-alpha-like protein 1; Cysteine-rich secreted protein A12-alpha-like 1; Cysteine-rich secreted protein FIZZ2; found in inflammatory zone 1; RELMbeta; Resistin-like beta; RSNB
Gene Aliases: CCRG; FIZZ1; FIZZ2; HXCP2; RELM-beta; RELMb; RELMbeta; RETNL2; RETNLB; UNQ408/PRO770; XCP2
UniProt ID: (Human) Q9BQ08
Entrez Gene ID: (Human) 84666
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support