Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human AKAP3 (aa 363-452) Control Fragment Recombinant Protein
Product Details
RP-109802
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
FSHGSQKATDIMDAMLRKLYNVMFAKKVPEHVRKAQDKAESYSLISMKGMGDPKNRNVNFAMKSETKLREKMYSEPKSEEETCAKTLGEH
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The type II cAMP-dependent protein kinase (PKA) is a multifunctional kinase with a broad range of substrates. Specificity of PKA signaling is mediated by the compartmentalization of the kinase to specific sites within the cell. To maintain this specific localization, the R subunit (RII) of PKA interacts with specific RII-anchoring proteins, designated A-kinase anchoring proteins (AKAP). AKAP 3, also known as AKAP 110, FSP95, PRKA3 and SOB1, binds both PKA and PDE4A and functions as a scaffolding protein in spermatozoa to regulate local cAMP concentrations and modulate sperm functions. Expression of AKAP 3 in normal tissues is restricted to the testis, where bicarbonate stimulates tyrosine phosphorylation of AKAP 3, thereby increasing its recruitment of PKA. AKAP-3 also exhibits high expression in patients with epithelial ovarian cancer (EOC). It demonstrates tumor-restricted expression and appears to be associated with worse overall survival, which make AKAP 3 a potential target for antigen-specific immunotherapy in EOC.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: A kinase (PRKA) anchor protein 3; A-kinase anchor protein 110 kDa; A-kinase anchor protein 3; A-kinase anchor protein, 110kDa; AKAP 110; AKAP-3; Cancer/testis antigen 82; CT82; epididymis luminal protein 159; Fibrous Sheath Protein of 95 kDa; fibrousheathin 1; Fibrousheathin I; Fibrousheathin-1; FSP95; PRKA3; protein kinase A binding protein AKAP 110; Protein kinase A-anchoring protein 3; Sperm oocyte-binding protein; sperm oocyte-binding protein 1
Gene Aliases: AKAP 110; AKAP110; AKAP3; CT82; FSP95; HEL159; PRKA3; SOB1
UniProt ID: (Human) O75969
Entrez Gene ID: (Human) 10566
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support