Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human APOBEC3G (aa 227-375) Control Fragment Recombinant Protein
Product Details
RP-91476
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
MHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRL
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (39%), Rat (39%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110643. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The Apoliprotein B mRNA-editing, enzyme-catalytic, polypeptide-like (APOBEC) 3 is a multi-isoform member of the cytidine deaminase family of enzymes that act on monomeric nucleoside and nucleotide substrates. Similar to TRIM5-a which targets incoming retroviral capsids, APOBEC3 plays a major role in cellular defense against retroviral infection as at least two isoforms, APOBEC3G and to a lesser extent APOBEC3F, can be incorporated HIV-1 virions and induce hypermutation in the newly synthesized viral DNA and thus destabilize the viral genome. This innate mechanism of retroviral resistance is counteracted by the HIV-1 Vif protein by inducing the ubiquitization and degradation of APOBEC3G; a single amino acid substitution (D128K) blocks APOBEC3G depletion without affecting its inhibitory activity.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: A3G; APOBEC-related cytidine deaminase; APOBEC-related protein; APOBEC-related protein 9; apolipoprotein B editing enzyme catalytic polypeptide-like 3G; apolipoprotein B mRNA editing enzyme catalytic polypeptide like 3G; apolipoprotein B mRNA editing enzyme cytidine deaminase; apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G; apolipoprotein B mRNA-editing enzyme catalytic polypeptide 3G; ARP-9; ASGP-R2; ASGPR2; CEM-15; CEM15; CLEC4H2; Deoxycytidine deaminase; DNA dC->dU editing enzyme; DNA dC->dU-editing enzyme APOBEC-3G; FLJ12740; HBXBP; HL-2; OTTHUMP00000028911; phorbolin-like protein MDS019
Gene Aliases: A3G; APOBEC3G; ARCD; ARP-9; ARP9; bK150C2.7; CEM-15; CEM15; dJ494G10.1; MDS019
UniProt ID: (Human) Q9HC16
Entrez Gene ID: (Human) 60489
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support