Search
Invitrogen
Human ATP5G2 (aa 39-117) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-101288
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
LCLLCSGSSSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQ
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62413. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
ATP5MC2 encodes the enzyme ATP5MC2, which is a subunit of the mitochondrial ATP synthase complex (Complex V). The ATP synthase complex is pivotal in the process of oxidative phosphorylation and ADP to ATP conversion, which is essential for energy production in the cell. The ATP5MC2 gene is located on chromosome 12. This subunit helps in forming the membrane channel of the F0 portion of the ATP synthase complex, facilitating proton translocation across the mitochondrial membrane. Mutations or dysfunction in this gene can lead to mitochondrial deficiencies and energy production disorders, which may have implications in various metabolic and neurodegenerative conditions.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: ATP synthase c subunit; ATP synthase F(0) complex subunit C2, mitochondrial; ATP synthase lipid-binding protein; ATP synthase lipid-binding protein, mitochondrial; ATP synthase membrane subunit c locus 2; ATP synthase proteolipid P2; ATP synthase proton-transporting mitochondrial F(0) complex subunit C2; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9); ATP synthase, H+ transporting, mitochondrial Fo complex subunit C2 (subunit 9); ATPase protein 9; ATPase subunit 9; ATPase subunit C; dicyclohexylcarbodiimide (DCCD)-reactive proteolipid subunit; unnamed protein product
Gene Aliases: ATP5A; ATP5G2; ATP5MC2; PSEC0033
UniProt ID: (Human) Q06055
Entrez Gene ID: (Human) 517
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support