Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human TRAIL (aa 238-273) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-103204
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
GLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEAS
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111405. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
TRAIL is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. TRAIL preferentially induces apoptosis in transformed and tumor cells, but does not appear to kill normal cells although it is expressed at a significant level in most normal tissues. TRAIL binds to several members of TNF receptor superfamily including TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and possibly also to TNFRSF11B/OPG. The activity of this protein may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4, and TNFRSF11B/OPG that cannot induce apoptosis. The binding of TRAIL protein to its receptors has been shown to trigger the activation of MAPK8/JNK, caspase 8, and caspase 3. Receptors for TRAIL include two death domain containing receptors, death receptor 4 (DR4) and DR5, as well as two decoy receptors, DcR1 and DcR2, lacking the intracellular signaling death domain. TRAIL is a type II membrane protein and expressed in a variety of human tissues. Like TNF and Fas ligand, TRAIL induces apoptosis and NF-kB activation in many tissues and cells.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Apo-2 ligand; Apo-2L; CD253; CD253 antigen; chemokine tumor necrosis factor ligand superfamily member 10; Protein TRAIL; TN; TNF superfamily member 10; TNF-related apoptosis inducing ligand TRAIL; TNF-related apoptosis-inducing ligand; TRAIL protein; tumor necrosis factor (ligand) family, member 10; tumor necrosis factor (ligand) superfamily member 10; tumor necrosis factor (ligand) superfamily, member 10; tumor necrosis factor apoptosis-inducing ligand splice variant delta; tumor necrosis factor ligand 6A; Tumor necrosis factor ligand superfamily member 10
Gene Aliases: Apo-2L; APO2L; CD253; TL2; TNFSF10; TNLG6A; TRAIL
UniProt ID: (Human) P50591
Entrez Gene ID: (Human) 8743
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support