Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
ASPH Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 5
ASPH Antibody (PA5-78827) in ICC/IF
Immunocytochemistry/Immunofluorescence analysis of ASPH in A549 cell using ASPH Polyclonal Antibody (Product # PA5-78827). Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and incubated with the primary antibody at 1 µg/mL. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Product Details
PA5-78827
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Published species
C. elegans,
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ASPH (726-758aa EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: Rat Brain Tissue, Rat Liver Tissue, HELA whole cell, HEPG2 whole cell, HEPA whole cell. IHC: Human Mammary Cancer tissue. ICC/IF: A549 cell. Flow: HeLa cell, U87 cell.
Target Information
ASPH is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins. This gene is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Bioinformatics
Protein Aliases: A beta H-J-J; ASP beta-hydroxylase; Aspartate beta-hydroxylase; aspartyl beta-hydroxylase; Aspartyl/asparaginyl beta-hydroxylase; aspartyl/asparaginyl-beta-hydroxylase; calsequestrin-binding protein; cardiac junctin; humbug; jumbug; junctate; junctin; Peptide-aspartate beta-dioxygenase
Gene Aliases: 2310005F16Rik; 3110001L23Rik; AAH; AI848629; ASPH; AW261690; AW561901; BAH; C79816; CASQ2BP1; cI-37; FDLAB; HAAH; JCTN; junctin
UniProt ID: (Human) Q12797, (Mouse) Q8BSY0
Entrez Gene ID: (Human) 444, (Rat) 312981, (Mouse) 65973
muscle contraction
pattern specification process
negative regulation of cell proliferation
regulation of protein stability
ion transmembrane transport
limb morphogenesis
peptidyl-aspartic acid hydroxylation
positive regulation of proteolysis
oxidation-reduction process
palate development
face morphogenesis
activation of cysteine-type endopeptidase activity
regulation of protein depolymerization
regulation of cardiac conduction
positive regulation of calcium ion transport into cytosol
peptidyl-amino acid modification
regulation of inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity
activation of store-operated calcium channel activity
response to ATP
positive regulation of transcription, DNA-templated
regulation of cytosolic calcium ion concentration
calcium ion transmembrane transport
cellular response to calcium ion
positive regulation of intracellular protein transport
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support