Search
Invitrogen
Human GADD45GIP1 (aa 84-117) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-103584
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
ELEAEEREWYPSLATMQESLRVKQLAEEQKRRER
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-111409, PA5-64199. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Inhibitor of nuclear factor kappa-B kinase subunit beta (IKK beta) is a serine kinase that plays an essential role in the NF-kaapa-B signaling pathway which is activated by mulitple stimuli such as inflammatory cytokines, bacterial, or viral products, DNA damages, or other cellular stresses. IKK beta acts as part of the canonical IKK complex in the conventional pathway of NF-kappa-B activation and phosphorylates inhibitors of NF-kappa-B on 2 critical serine residues. These modifications allow polyubiquitination of the inhibitors and subsequent degradation by the proteasome. In turn, free NF-kappa-B is translocated into the nucleus and activates the transcription of hundreds of genes involved in immune response, growth control, or protection against apoptosis. Mutations affecting the IKK beta gene can result in Immunodeficiency 15 (IMD15).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 39S ribosomal protein L59, mitochondrial; CKBBP2; CKII beta binding protein 2; CKII beta-associating protein; CR6 interacting factor 1; CR6-interacting factor 1; CRIF1; Growth arrest and DNA damage-inducible proteins-interacting protein 1; growth arrest and DNA-damage-inducible, gamma interacting protein 1; growth arrest- and DNA damage-inducible GADD45G-interacting protein; Large ribosomal subunit protein mL64; mitochondrial large ribosomal subunit protein CRIF1; mitochondrial large ribosomal subunit protein mL64; MRP-L59; p53-responsive gene 6 protein; papillomavirus L2 interacting nuclear protein 1; Papillomavirus L2-interacting nuclear protein 1; PLINP
Gene Aliases: CKBBP2; CKbetaBP2; CRIF1; GADD45GIP1; mL64; MRP-L59; MRPL59; PLINP; PLINP-1; PLINP1; PRG6
UniProt ID: (Human) Q8TAE8
Entrez Gene ID: (Human) 90480
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support