Search
Invitrogen
Human Carbonic Anhydrase XIII (aa 10-92) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-93943
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
EHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLR
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55154. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Carbonic anhydrase XII (CA XII), encoded by the CA12 gene, is one of the enzyme isoforms in the carbonic anhydrase family that catalyzes the reversible hydration of carbon dioxide into bicarbonate and protons. CA XII is a transmembrane protein expressed in various tissues, including the kidneys, intestines, and lungs, playing crucial roles in maintaining acid-base balance, pH regulation, and electrolyte transport. Its activity is significant in organs where fluid secretion and absorption are essential processes, impacting functions such as respiration and renal bicarbonate reabsorption. CA XII is involved in physiological processes like cell proliferation and differentiation by modulating the extracellular and intracellular pH, influencing tumor microenvironment dynamics. Aberrant expression of CA XII has been noted in several cancers, including breast and colorectal cancers, where it supports tumor growth and metastasis by maintaining the acid-base homeostasis conducive to cancer cell survival. Due to its surface expression and role in maintaining pH balance, CA XII is a target of interest for therapeutic interventions aiming to disrupt tumor progression and enhance the efficacy of cancer treatments.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CA-XIII; Carbonate dehydratase XIII; Carbonic anhydrase 13; Carbonic anhydrase XIII; unnamed protein product
Gene Aliases: CA13; CAXIII
UniProt ID: (Human) Q8N1Q1
Entrez Gene ID: (Human) 377677
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support