Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human PI3K p85 alpha (aa 182-328) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-95921
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
LADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSL
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110625. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Phosphatidylinositol 3-kinase (PIK3) is a signaling protein that phosphorylates the inositol ring of phosphatidylinositol at the 3-prime position. Signaling is initiated when upstream tyrosine kinase receptors or G protein coupled receptors are bound by their ligands. It binds to activated (phosphorylated) protein-Tyr kinases, through its SH2 domain, and acts as an adapter, mediating the association of the p110 catalytic unit to the plasma membrane. Phosphatidylinositol 3-kinase plays an important role in the metabolic actions of insulin, and a mutation in this gene has been associated with insulin resistance. During insulin stimulation, it also binds to IRS-1. Mutations in the gene can result in Agammaglobulinemia 7, SHORT syndrome, or Immunodeficiency 36.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: p55-GAMMA; p55PIK; phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma; Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha; Phosphatidylinositol 3-kinase regulatory subunit alpha; phosphatidylinositol 3-kinase regulatory subunit gamma; phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha); phosphatidylinositol 3-kinase-associated p-85 alpha; phosphoinositide-3-kinase regulatory subunit; phosphoinositide-3-kinase regulatory subunit alpha; phosphoinositide-3-kinase, regulatory subunit 1 (alpha); PI3-kinase p85-subunit alpha; PI3-kinase regulatory subunit alpha; PI3-kinase regulatory subunit gamma; PI3-kinase subunit p55-gamma; PI3-kinase subunit p85-alpha; PI3K regulatory subunit alpha; PI3K regulatory subunit gamma; polypeptide 1 p85 alpha; ptdIns-3-kinase regulatory subunit alpha; PtdIns-3-kinase regulatory subunit p85-al; RP4-533D7.2
Gene Aliases: AGM7; GRB1; IMD36; p85; p85-ALPHA; PIK3R1
UniProt ID: (Human) P27986
Entrez Gene ID: (Human) 5295
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support