Search

  • お問い合わせ一覧​
  • クイックオーダー

Invitrogen

TGFBR2 Monoclonal Antibody (2F11)

Advanced Verification
View all (24) TGFBR2 antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Additional Information:
{{banner.description}}
{{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
TGFBR2 Monoclonal Antibody (2F11)

Product Details

MA5-49166

Applications
Tested Dilution
Publications

Western Blot (WB)

0.25-0.5 µg/mL
-

Immunohistochemistry (Paraffin) (IHC (P))

2-5 µg/mL
-

Immunocytochemistry (ICC/IF)

5 µg/mL
-

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells
-
Product Specifications

Species Reactivity

Human

Host/Isotype

Mouse / IgG2b

Class

Monoclonal

Type

Antibody

Clone

2F11

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR2 (96-128aa TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK).
3D Epitope / Immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Amount

100 µg

Purification

Antigen affinity chromatography

Storage buffer

PBS with 4mg trehalose

Contains

no preservative

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_3074824

Product Specific Information

Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.

Immunogen sequence different from the related mouse sequence by five amino acids, and from the related rat sequence by eight amino acids.

Positive Control - WB: human HepG2 whole cell, human A549 whole cell, human K562 whole cell, human Caco-2 whole cell, human Hela whole cell, human T-47D whole cell. IHC: human placenta tissue, human cervical intraepithelial neoplasia tissue, human esophageal squamous carcinoma tissue. ICC/IF: HepG2 cell. Flow: A549 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Target Information

Transforming Growth Factor, beta receptor 2 (AAT3, FAA3, MFS2, RIIC, LDS1B, LDS2B, TAAD2, TGFR-2, TGFbeta-RII) is a member of the TGF-beta family of receptor Serine/Threonine kinases. It is involved in the regulation of cell proliferation. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). TGFBR2 encodes the gamma subunit of the catalytic core. Alternatively spliced transcript variants encoding different isoforms have been identified. TGFBR2 also has a pseudogene on chromosome 14.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: Ser/Thr protein kinase; tgf beta receptor 2; TGF-beta receptor type II; TGF-beta receptor type IIB; TGF-beta receptor type-2; TGF-beta type II receptor; TGFbeta RII; TGFBR2-SE; TGFR-2; TGFR2; transforming growth factor beta receptor II; transforming growth factor beta receptor II (70/80kDa) isoform TGFBR2_1; transforming growth factor beta receptor II (70/80kDa) isoform TGFBR2_2; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor II (70/80kDa); transforming growth factor, beta receptor II alpha; transforming growth factor, beta receptor II beta; transforming growth factor, beta receptor II delta; transforming growth factor, beta receptor II epsilon; transforming growth factor, beta receptor II gamma; Transforming growth factor-beta receptor type II; unnamed protein product

View more View less

Gene Aliases: AAT3; FAA3; LDS1B; LDS2; LDS2B; MFS2; RIIC; TAAD2; tbetaR-II; TBR-ii; TBRII; TGFbeta-RII; TGFBR2; TGFR-2

View more View less

UniProt ID: (Human) P37173

View more View less

Entrez Gene ID: (Human) 7048

View more View less

Function(s)
nucleotide binding protein kinase activity protein serine/threonine kinase activity transmembrane receptor protein serine/threonine kinase activity transforming growth factor beta-activated receptor activity transforming growth factor beta receptor activity, type II protein binding ATP binding glycosaminoglycan binding kinase activity activin receptor activity, type I transferase activity kinase activator activity type I transforming growth factor beta receptor binding type III transforming growth factor beta receptor binding signaling receptor activity SMAD binding metal ion binding activin binding transforming growth factor beta binding binding, bridging
Process(es)
blood vessel development patterning of blood vessels vasculogenesis in utero embryonic development epithelial to mesenchymal transition heart looping positive regulation of mesenchymal cell proliferation lens development in camera-type eye positive regulation of tolerance induction to self antigen positive regulation of B cell tolerance induction positive regulation of T cell tolerance induction outflow tract septum morphogenesis membranous septum morphogenesis outflow tract morphogenesis aortic valve morphogenesis atrioventricular valve morphogenesis tricuspid valve morphogenesis cardiac left ventricle morphogenesis endocardial cushion fusion growth plate cartilage development growth plate cartilage chondrocyte growth apoptotic process transmembrane receptor protein serine/threonine kinase signaling pathway transforming growth factor beta receptor signaling pathway Notch signaling pathway smoothened signaling pathway gastrulation nervous system development brain development heart development positive regulation of cell proliferation response to xenobiotic stimulus regulation of gene expression positive regulation of epithelial cell migration positive regulation of epithelial to mesenchymal transition cell differentiation lung development activin receptor signaling pathway response to lipid embryonic hemopoiesis aorta morphogenesis regulation of cell proliferation myeloid dendritic cell differentiation positive regulation of angiogenesis animal organ development blood vessel morphogenesis embryonic cranial skeleton morphogenesis artery morphogenesis positive regulation of developmental process positive regulation of NK T cell differentiation cartilage development regulation of multicellular organismal process palate development positive regulation of SMAD protein import into nucleus SMAD protein signal transduction ventricular septum morphogenesis lung morphogenesis bronchus development bronchus morphogenesis trachea morphogenesis trachea formation mammary gland morphogenesis lung lobe morphogenesis Langerhans cell differentiation secondary palate development response to cholesterol cellular response to growth factor stimulus regulation of stem cell proliferation positive regulation of epithelial to mesenchymal transition involved in endocardial cushion formation cell proliferation involved in endocardial cushion morphogenesis superior endocardial cushion morphogenesis inferior endocardial cushion morphogenesis lens fiber cell apoptotic process miRNA transport positive regulation of reactive oxygen species metabolic process positive regulation of CD4-positive, alpha-beta T cell proliferation regulation of stem cell differentiation
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support