Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR1, identical to the related mouse and rat sequences. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 4mg trehalose |
Contains |
no preservative |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2807190 |
Synthetic peptide sequence: 149-186aa, HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. The encoded protein is a serine/threonine protein kinase. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: activin A receptor type II-like kinase, 53kDa; Activin A receptor type II-like protein kinase of 53kD; Activin receptor-like kinase 5; ALK-5; ESK2; mutant transforming growth factor beta receptor I; ser; Serine/threonine-protein kinase receptor R4; SKR4; tgf beta receptor 1; TGF-beta receptor type I; TGF-beta receptor type-1; TGF-beta type I receptor; TGFR-1; TGFR1; Transfor; transforming growth factor beta receptor I; transforming growth factor, beta receptor 1; transforming growth factor, beta receptor I; Transforming growth factor-beta receptor type I
Gene Aliases: AAT5; ACVRLK4; ALK-5; ALK5; AU017191; ESS1; LDS1; LDS1A; LDS2A; MSSE; SKR4; TbetaR-I; TbetaRI; TGFBR1; TGFR-1
UniProt ID: (Human) P36897, (Rat) P80204, (Mouse) Q64729
Entrez Gene ID: (Human) 7046, (Rat) 29591, (Mouse) 21812
Molecular Function:
serine/threonine protein kinase receptor
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support