Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
  • Special Offers
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • TGFBR1 Antibodies

          Invitrogen

          TGFBR1 Polyclonal Antibody

          View all (22) TGFBR1 antibodies
          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite TGFBR1 Polyclonal Antibody

          • Antibody Testing Data (1)
          TGFBR1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          TGFBR1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 1

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          TGFBR1 Antibody (PA5-95387) in WB

          Western blot analysis of TGFBR1 in rat cardiac muscle extract (lane 1), mouse liver extract (lane 2) and HeLa whole cell lysates (lane 3). Samples were incubated with TGFBR1 polyclonal antibody (Product # PA5-95387) using a 0.5 µg/mL dilution. developed was performed using enhanced chemiluminescence (ECL). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          TGFBR1 Antibody in Western Blot (WB)

          Product Details

          PA5-95387

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR1 (149-186aa HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807190

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: rat cardiac muscle tissue, mouse liver tissue, HELA whole cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          TGFBR1 is a transmembrane serine/threonine kinase in the TGFBR1 superfamily, which also includes ACVRs and BMPRs. Upon binding TGF-b, TGFBR2 dimerizes with and activates TGFBR1 via phosphorylation leading to downstream phosphorylation of SMADs by TGFBR1. TGFBR1 forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. The encoded protein is a serine/threonine protein kinase. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS).

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: activin A receptor type II-like kinase, 53kDa; Activin A receptor type II-like protein kinase of 53kD; Activin receptor-like kinase 5; ALK-5; ESK2; mutant transforming growth factor beta receptor I; ser; Serine/threonine-protein kinase receptor R4; SKR4; tgf beta receptor 1; TGF-beta receptor type I; TGF-beta receptor type-1; TGF-beta type I receptor; TGFR-1; TGFR1; Transfor; transforming growth factor beta receptor I; transforming growth factor, beta receptor 1; transforming growth factor, beta receptor I; Transforming growth factor-beta receptor type I

          View more View less

          Gene Aliases: AAT5; ACVRLK4; ALK-5; ALK5; AU017191; ESS1; LDS1; LDS1A; LDS2A; MSSE; SKR4; TbetaR-I; TbetaRI; TGFBR1; TGFR-1

          View more View less

          UniProt ID: (Human) P36897, (Rat) P80204, (Mouse) Q64729

          View more View less

          Entrez Gene ID: (Human) 7046, (Rat) 29591, (Mouse) 21812

          View more View less

          Function(s)
          protein kinase activity protein serine/threonine kinase activity receptor signaling protein serine/threonine kinase activity transforming growth factor beta-activated receptor activity transforming growth factor beta receptor activity, type I receptor signaling protein activity type II transforming growth factor beta receptor binding protein binding ATP binding growth factor binding SMAD binding metal ion binding transforming growth factor beta binding I-SMAD binding ubiquitin protein ligase binding protein complex binding protein heterodimerization activity nucleotide binding transmembrane receptor protein serine/threonine kinase activity kinase activity transferase activity transferase activity, transferring phosphorus-containing groups serine/threonine protein kinase receptor
          Process(es)
          activation of MAPKK activity skeletal system development angiogenesis in utero embryonic development kidney development blastocyst development epithelial to mesenchymal transition negative regulation of endothelial cell proliferation positive regulation of endothelial cell proliferation lens development in camera-type eye ventricular trabecula myocardium morphogenesis ventricular compact myocardium morphogenesis proepicardium development regulation of transcription, DNA-templated protein phosphorylation apoptotic process cell cycle arrest signal transduction transforming growth factor beta receptor signaling pathway heart development positive regulation of cell proliferation germ cell migration male gonad development post-embryonic development anterior/posterior pattern specification regulation of epithelial to mesenchymal transition positive regulation of epithelial to mesenchymal transition positive regulation of pathway-restricted SMAD protein phosphorylation peptidyl-serine phosphorylation peptidyl-threonine phosphorylation signal transduction by protein phosphorylation collagen fibril organization positive regulation of cell growth positive regulation of cell migration negative regulation of transforming growth factor beta receptor signaling pathway regulation of protein ubiquitination negative regulation of chondrocyte differentiation activin receptor signaling pathway intracellular signal transduction wound healing endothelial cell activation extracellular structure organization regulation of protein binding endothelial cell migration positive regulation of transcription, DNA-templated thymus development neuron fate commitment embryonic cranial skeleton morphogenesis skeletal system morphogenesis mesenchymal cell differentiation artery morphogenesis cell motility positive regulation of cellular component movement positive regulation of filopodium assembly positive regulation of stress fiber assembly positive regulation of protein kinase B signaling parathyroid gland development palate development pharyngeal system development regulation of cardiac muscle cell proliferation cardiac epithelial to mesenchymal transition pathway-restricted SMAD protein phosphorylation positive regulation of SMAD protein import into nucleus ventricular septum morphogenesis coronary artery morphogenesis response to cholesterol cellular response to transforming growth factor beta stimulus positive regulation of epithelial to mesenchymal transition involved in endocardial cushion formation positive regulation of occluding junction disassembly positive regulation of apoptotic signaling pathway negative regulation of extrinsic apoptotic signaling pathway response to hypoxia transmembrane receptor protein serine/threonine kinase signaling pathway embryo implantation aging response to toxic substance regulation of gene expression positive regulation of gene expression response to organic cyclic compound lung development organ regeneration response to prostaglandin E regulation of growth negative regulation of apoptotic process response to estrogen negative regulation of endothelial cell differentiation protein autophosphorylation digestive tract development response to electrical stimulus embryo development phosphorylation cell differentiation
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-green-6ff95d844f-mjdcb:80/100.66.78.27:80.
          git-commit: f44aa9153aef922f8fad9a05e87b8aee811da128
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.28.0-Offline