Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Cell Analysis
    • Antibodies
    • Mass Spectrometry
    • Cell Culture
    • Laboratory Instruments
    • Clinical and Diagnostics
    • Chromatography
    • Laboratory Equipment
    • Laboratory Supplies
    • Molecular Biology and Nucleic Acid Analysis
    • Sequence-Specific Nucleic Acid Products
    • See all product categories
  • Applications
    • Cell Culture and Transfection
    • Flow Cytometry
    • Cancer Research
    • Chromatography
    • Sequencing
    • PCR
    • Lab Solutions
    • Allergy Diagnostics
    • See all applications and techniques
  • Services
    • Cell Biology Services
    • Custom Services
    • Training Services
    • Lab Informatics Services
    • Financial and Leasing Services
    • Partnering and Licensing Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Food Safety Inspection Services
    • See all services
  • Help and Support
    • How to Order
    • Promotions and Online Offers
    • Contact Us
    • Change Location
    • Create a New Account
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Special Offers
  • Contact Us
  • Quick Order
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Contact Us
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
          • Primary Antibodies ›
          • TGFBR1 Antibodies

          Invitrogen

          TGFBR1 Polyclonal Antibody

          View all (22) TGFBR1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite TGFBR1 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (1)
          TGFBR1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          TGFBR1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 1

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          TGFBR1 Antibody (PA5-95387) in WB

          Western blot analysis of TGFBR1 in rat cardiac muscle extract (lane 1), mouse liver extract (lane 2) and HeLa whole cell lysates (lane 3). Samples were incubated with TGFBR1 polyclonal antibody (Product # PA5-95387) using a 0.5 µg/mL dilution. developed was performed using enhanced chemiluminescence (ECL). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          TGFBR1 Antibody in Western Blot (WB)
          TGFBR1 Polyclonal Antibody

          Product Details

          PA5-95387

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR1 (149-186aa HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807190

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: rat cardiac muscle tissue, mouse liver tissue, HELA whole cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          TGFBR1 is a transmembrane serine/threonine kinase in the TGFBR1 superfamily, which also includes ACVRs and BMPRs. Upon binding TGF-b, TGFBR2 dimerizes with and activates TGFBR1 via phosphorylation leading to downstream phosphorylation of SMADs by TGFBR1. TGFBR1 forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. The encoded protein is a serine/threonine protein kinase. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS).

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: activin A receptor type II-like kinase, 53kDa; Activin A receptor type II-like protein kinase of 53kD; Activin receptor-like kinase 5; ALK-5; ESK2; mutant transforming growth factor beta receptor I; ser; Serine/threonine-protein kinase receptor R4; SKR4; tgf beta receptor 1; TGF-beta receptor type I; TGF-beta receptor type-1; TGF-beta type I receptor; TGFR-1; TGFR1; Transfor; transforming growth factor beta receptor I; transforming growth factor, beta receptor I; Transforming growth factor-beta receptor type I; unnamed protein product

          View more View less

          Gene Aliases: AAT5; ACVRLK4; ALK-5; ALK5; AU017191; ESS1; LDS1; LDS1A; LDS2A; MSSE; SKR4; TbetaR-I; TbetaRI; TBR-i; TBRI; TGFBR1; TGFR-1

          View more View less

          UniProt ID: (Human) P36897, (Rat) P80204, (Mouse) Q64729

          View more View less

          Entrez Gene ID: (Human) 7046, (Rat) 29591, (Mouse) 21812

          View more View less

          Function(s)
          nucleotide binding protein kinase activity protein serine/threonine kinase activity transmembrane receptor protein serine/threonine kinase activity transforming growth factor beta-activated receptor activity transforming growth factor beta receptor activity, type I receptor binding type II transforming growth factor beta receptor binding protein binding ATP binding kinase activity activin receptor activity, type I transferase activity growth factor binding ubiquitin protein ligase binding SMAD binding metal ion binding activin binding transforming growth factor beta binding I-SMAD binding receptor signaling protein serine/threonine kinase activity receptor signaling protein activity protein complex binding protein heterodimerization activity transferase activity, transferring phosphorus-containing groups serine/threonine protein kinase receptor
          Process(es)
          skeletal system development angiogenesis in utero embryonic development kidney development blastocyst development epithelial to mesenchymal transition endothelial cell proliferation negative regulation of endothelial cell proliferation positive regulation of endothelial cell proliferation lens development in camera-type eye ventricular trabecula myocardium morphogenesis ventricular compact myocardium morphogenesis proepicardium development regulation of transcription, DNA-templated apoptotic process signal transduction transmembrane receptor protein serine/threonine kinase signaling pathway transforming growth factor beta receptor signaling pathway nervous system development heart development positive regulation of cell proliferation germ cell migration male gonad development post-embryonic development anterior/posterior pattern specification regulation of gene expression positive regulation of gene expression regulation of epithelial to mesenchymal transition positive regulation of epithelial to mesenchymal transition peptidyl-serine phosphorylation cell differentiation collagen fibril organization positive regulation of cell growth regulation of cell migration positive regulation of cell migration negative regulation of cell migration regulation of protein ubiquitination negative regulation of chondrocyte differentiation activin receptor signaling pathway intracellular signal transduction myofibroblast differentiation wound healing endothelial cell activation extracellular structure organization positive regulation of apoptotic process negative regulation of apoptotic process endothelial cell migration positive regulation of transcription, DNA-templated filopodium assembly thymus development neuron fate commitment embryonic cranial skeleton morphogenesis skeletal system morphogenesis mesenchymal cell differentiation artery morphogenesis cell motility positive regulation of filopodium assembly positive regulation of stress fiber assembly regulation of cell cycle positive regulation of protein kinase B signaling parathyroid gland development palate development pharyngeal system development regulation of cardiac muscle cell proliferation cardiac epithelial to mesenchymal transition positive regulation of SMAD protein import into nucleus ventricular septum morphogenesis angiogenesis involved in coronary vascular morphogenesis coronary artery morphogenesis trophoblast cell migration response to cholesterol cellular response to growth factor stimulus cellular response to transforming growth factor beta stimulus response to alcohol vascular endothelial cell proliferation positive regulation of extracellular matrix assembly positive regulation of mesenchymal stem cell proliferation positive regulation of vasculature development positive regulation of epithelial to mesenchymal transition involved in endocardial cushion formation positive regulation of occluding junction disassembly epicardium morphogenesis regulation of multicellular organismal development positive regulation of apoptotic signaling pathway negative regulation of extrinsic apoptotic signaling pathway activation of MAPKK activity response to hypoxia protein phosphorylation embryo implantation aging response to toxic substance positive regulation of pathway-restricted SMAD protein phosphorylation response to organic cyclic compound peptidyl-threonine phosphorylation signal transduction by protein phosphorylation lung development organ regeneration response to prostaglandin E regulation of growth regulation of protein binding response to estrogen negative regulation of endothelial cell differentiation protein autophosphorylation digestive tract development positive regulation of cellular component movement response to electrical stimulus pathway-restricted SMAD protein phosphorylation embryo development phosphorylation
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          • Social Media
          • Contact Us
          • Report a Site Issue
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Argentina flag icon
          Argentina

          Your items have has been added!


          Host server : magellan-search-blue-744bc48644-454p7:80/100.66.72.101:80.
          git-commit: 747bde55a712f6f97bf7760408d445eefba4e16f
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.48.0-Offline