Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
| Applications | Tested Dilution | Publications |
|---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
| Product Specifications | |
|---|---|
Species Reactivity |
Human |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the C-terminus of human MUC3. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2807158 |
Synthetic peptide sequence: DLNDNTSQAYRDFNKTFWNQMQKIFADMQGFTFK.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Major glycoprotein component of a variety of mucus gels. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: mucin 3
Gene Aliases: MUC3; MUC3A
Entrez Gene ID: (Human) 57876
Molecular Function:
cell adhesion molecule
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support
