Search Thermo Fisher Scientific
Search Thermo Fisher Scientific
PA1-24260 detects Cullin 1 (CUL-1) in human samples.
PA1-24260 has been successfully used in Western blot procedures.
The PA1-24260 immunogen is a synthetic peptide corresponding to residues HQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA of human CUL1.
CUL1 gene ontology annotations related to this gene include animal organ morphogenesis; apoptotic process; cell proliferation; protein monoubiquitination; SCF-dependent proteasomal ubiquitin-dependent protein catabolic process.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support