Search Thermo Fisher Scientific
Search Thermo Fisher Scientific
Invitrogen
This Antibody was verified by Relative expression to ensure that the antibody binds to the antigen stated.
The synthetic peptide sequence is 30-60aa, ASRDDWRCARSMHEFSAKDIDGHMVNLDKYR
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support