Search Thermo Fisher Scientific
Search Thermo Fisher Scientific
FIGURE: 1 / 1
Synthetic peptide sequence: 127-155aa, AAFPGLGQVPKQLAQLSEAKDLQARKAFN.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Zinc finger protein SNAI1 (SNAIL)is a zinc finger transcriptional repressor which down regulates the expression of the ectodermal gene within the mesoderm and functions to form the mesoderm and neural crest. It is reported that SNAI1 acts as an important factor of tumor invasion as evidenced by its role in E-cadherin down-regulation and induction of epithelial-mesenchymal transition (EMT). In human breast cancer, the expression of SNAI1 and/or the homologous SNAI2 (Slug) has been associated with E-cadherin repression, local or distant metastasis, tumor recurrence, or poor prognosis in different tumor series. It is also reported that Snail 1 protein in the stromamay be anew putative prognosis marker for colon tumors.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support