Search Thermo Fisher Scientific
Search Thermo Fisher Scientific
This target displays homology in the following species: Rat: 100%
Peptide sequence: MQNWETTATTNYEQHNAWYNSMFAANIKQEPGHHLDGNSVASSPRQSPIP
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration is batch dependent: 0.5-1 mg/mL
Gap class segmentation protein that controls development of head structures.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: CG9786-PA; CG9786-PB; hb-PA; hb-PB; LD14196p; Protein hunchback; Regulator-of-postbithorax
Gene Aliases: CG9786; Dmel\CG9786; Dmel_CG9786; HB; hbHLH; Hunchback; l(3)85Ah; R-pbx; Rg-bx; Rg-pbx
UniProt ID: (Fruit fly) P05084
Entrez Gene ID: (Fruit fly) 41032
Molecular Function: C2H2 zinc finger transcription factor
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support