Search Thermo Fisher Scientific
Search Thermo Fisher Scientific
The synthetic peptide sequence is 31-67aa, QWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVAR
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
Interferons (IFNs) are involved in a multitude of immune interactions during viral infections and play a major role in both the induction and regulation of innate and adaptive antiviral mechanisms. During infection, host-virus interactions signal downstream molecules such as transcription factors such as IFN regulatory factor-3 (IRF3) which can act to stimulate transcription of IFN-a/b genes. IRF7 has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain genes. IRF7 play a major role in the innate immune pathway, interacting with the Toll-like receptor (TLR) adaptor proteins MyD88 and Tirp/TRAM and functioning as an intermediate TLR4 and TLR9 signaling. There are at least four differentially spliced isoforms of IRF7, although their function has not been clearly established.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support