Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Promotions
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central
          • Primary Antibodies ›
          • CaV1.2 Antibodies

          Alomone Labs, LTD

          CaV1.2a (CACNA1C) Polyclonal Antibody

          View all (38) CaV1.2 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers

          Cite CaV1.2a (CACNA1C) Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (2)
          CaV1.2a (CACNA1C) Antibody in Immunohistochemistry (IHC)
          Group 53 Created with Sketch.
          CaV1.2a (CACNA1C) Antibody in Immunohistochemistry (IHC)
          Group 53 Created with Sketch.

          FIGURE: 1 / 2

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          CaV1.2a (CACNA1C) Antibody (ACC-013-200UL) in IHC

          Expression of CaV1.2a inrat heart - Immunohistochemical staining of rat heart with Anti-CaV1.2a (CACNA1C) Antibody (#ACC-013). CaV1.2a was visualized with immuno-peroxidase methods and final brown-black diaminobenzidine color product (arrows in A). Cresyl violet is used as the counterstain. When the Antibody was pre-incubated with the control peptide antigen, staining was blocked (B). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          CaV1.2a (CACNA1C) Antibody in Immunohistochemistry (IHC)
          CaV1.2a (CACNA1C) Antibody in Western Blot (WB)
          CaV1.2a (CACNA1C) Polyclonal Antibody

          Product Details

          ACC-013-200UL

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          1:200
          -

          Immunohistochemistry (IHC)

          Assay-dependent
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rabbit, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          GST fusion protein with the sequence MLRALVQPATPAYQPLPSHLSAETESTCKGTVVHEAQLNHFYISPG, corresponding to amino acid residues 1-46 of rabbit CaV1.2a, with serine 44 replaced with alanine, Intracellular, N-terminus
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          0.95 mg/mL

          Amount

          190 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS, pH 7.4, with 1% BSA

          Contains

          0.05% sodium azide

          Storage conditions

          -20°C, Avoid Freeze/Thaw Cycles

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          Product Specific Information

          Reconstitution: 25 µL, 50 µL or 0.2 mL double distilled water (DDW), depending on the sample size. The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20C. The reconstituted solution can be stored at 4C for up to 1 week. For longer periods, small aliquots should be stored at -20C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

          Target Information

          CACNA1C encodes an alpha-1 subunit of a voltage-dependent calcium channel. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization. The alpha-1 subunit consists of 24 transmembrane segments and forms the pore through which ions pass into the cell. The calcium channel consists of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. There are multiple isoforms of each of these proteins, either encoded by different genes or the result of alternative splicing of transcripts. The protein encoded by CACNA1C binds to and is inhibited by dihydropyridine. Alternative splicing results in many transcript variants encoding different proteins.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: brain class C; CaCB receptor; CACB-receptor; CACH3; CACN4; CACNA 1D; CACNA1C intronic transcript 2; CACNA1C intronic transcript 2 (non-protein coding); CACNL1A2; calcium channel voltage-dependent alpha1c subunit; calcium channel, cardic dihydropyridine-sensitive, alpha-1 subunit; Calcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac muscle; calcium channel, voltage-dependent, alpha 1C subunit; calcium channel, voltage-dependent, L type, alpha 1C subunit; CaV1.2; DHP receptor; DHPR, alpha-1 subunit; L-type calcium channel alpha-1 subunit; long-NT; LTCC; MBC; MELC-CC; MGC120730; Mouse brain class C; neuronal voltage-gated calcium channel alpha 1C subunit; Rat brain class C; RBC; skeletal muscle-specific calcium channel; smooth muscle calcium channel blocker; Smooth muscle calcium channel blocker receptor; unnamed protein product; voltage-dependent L-type Ca2+ channel alpha 1 subunit; Voltage-dependent L-type calcium channel subunit alpha-1C; Voltage-gated calcium channel subunit alpha Cav1.2

          View more View less

          Gene Aliases: CACB; CACH2; CACN2; CACNA1C; CACNA1C-IT2; CACNL1A1; CaV1.2; CCHL1A1; D930026N18Rik; LQT8; MBC; MELC-CC; NEDHLSS; RATIVS302; TS; TS. LQT8

          View more View less

          UniProt ID: (Human) Q13936, (Rabbit) P15381, (Mouse) Q01815, (Rat) P22002

          View more View less

          Entrez Gene ID: (Rabbit) 100144322, (Human) 775, (Rabbit) 100101555, (Mouse) 12288, (Rat) 24239

          View more View less

          Function(s)
          ion channel activity voltage-gated calcium channel activity calcium channel activity protein binding calmodulin binding high voltage-gated calcium channel activity metal ion binding alpha-actinin binding voltage-gated calcium channel activity involved in cardiac muscle cell action potential voltage-gated calcium channel activity involved in AV node cell action potential voltage-gated ion channel activity enzyme binding protein domain specific binding ion channel binding protein phosphatase 2A binding voltage-gated ion channel
          Process(es)
          immune system development ion transport calcium ion transport muscle contraction positive regulation of cytosolic calcium ion concentration heart development regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion ion transmembrane transport embryonic forelimb morphogenesis camera-type eye development positive regulation of adenylate cyclase activity positive regulation of muscle contraction transmembrane transport calcium ion transport into cytosol cardiac conduction calcium ion transmembrane transport via high voltage-gated calcium channel calcium ion transmembrane transport cardiac muscle cell action potential involved in contraction membrane depolarization during cardiac muscle cell action potential membrane depolarization during AV node cell action potential cell communication by electrical coupling involved in cardiac conduction regulation of heart rate by cardiac conduction calcium ion import across plasma membrane regulation of ventricular cardiac muscle cell action potential membrane depolarization during atrial cardiac muscle cell action potential transport cellular calcium ion homeostasis smooth muscle contraction chemical synaptic transmission adult walking behavior regulation of blood pressure visual learning calcium ion regulated exocytosis regulation of vasoconstriction insulin secretion growth hormone secretion regulation of ion transmembrane transport glucose homeostasis regulation of organ growth smooth muscle contraction involved in micturition calcium ion import membrane depolarization during action potential
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy Consumer Health Data Privacy Policy
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Notice
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-8dsbr:80/100.66.76.150:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline