Hamburger Menu Button
Thermo Fisher Scientific Logo
로그인
회원이 아니신가요? 계정 생성하기
  • 모든 제품 주문
    • 항체
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR 분석
    • 피펫 및 피펫 팁
    • 실험실용 원심분리기
    • 초저온 냉동고
    • 분광학
    • 비이커
    • PCR 장비 및 용품
    • 제품 카테고리 전체보기
  • 응용 분야 및 기법
    • 세포 분석
    • 실험실 장비
    • Real-Time PCR
    • PCR
    • 크로마토그래피
    • 세포 배양 및 트랜스펙션
    • DNA/RNA 추출과 분석
    • 단백질 생물학
    • 유세포분석
    • 화학 제품
    • 응용 분야 및 기법 전체보기
  • 서비스
    • 맞춤형 서비스
    • 엔터프라이즈급 실험실 정보 처리
    • 360° CDMO 및 CRO 서비스
    • CDMO 서비스
    • 임상시험 CRO 서비스
    • 장비 서비스
    • 교육 서비스
    • Unity Lab Services
    • 서비스 전체 보기
  • 지원
    • 고객센터
    • 문의하기
    • 시험성적서(COA) 및 적합성 인증서(COC)
    • Safety Data Sheets (SDS)
    • 매뉴얼
    • 인용 및 참고 문헌
    • 기기 지원
    • 기술 자료/제품 FAQ
    • 학습 센터
    • 지원 메뉴 전체보기
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • 문의하기
  • 빠른 주문
  • 주문 현황
  • 제품 문서 검색
Thermo Fisher Scientific Logo

Search

전체검색
Search button
          • 주문 현황
          • 빠른주문
          • 로그인
            로그인
            회원이 아니신가요? 계정 생성하기
            • 계정정보
            • 주문내역조회
            • 커스텀제품 및 프로젝트
            • Services Central
          • Primary Antibodies ›
          • AGO2 Antibodies

          Invitrogen

          AGO2 Polyclonal Antibody

          View all (30) AGO2 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite AGO2 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (1)
          AGO2 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          AGO2 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 1

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          AGO2 Antibody (PA5-78738) in WB

          Western blot analysis of AGO2 using AGO2 Polyclonal Antibody (Product # PA5-78738). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 µg of sample under reducing conditions. Lane 1: human Jurkat whole cell lysates. Lane 2: human 293T whole cell lysates. Lane 3: human K562 whole cell lysates. Lane 4: human MCF-7 whole cell lysates. Lane 5: rat lung tissue lysates. Lane 6: rat pancreas tissue lysates. Lane 7: mouse pancreas tissue lys... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          AGO2 Antibody in Western Blot (WB)
          AGO2 Polyclonal Antibody

          Product Details

          PA5-78738

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human Ago2/ eIF2C2 (129-169aa KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2745854

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human Jurkat whole cell, human 293T whole cell, human K562 whole cell, human MCF-7 whole cell, rat lung tissue, rat pancreas tissue, mouse pancreas tissue.

          Target Information

          Ago proteins are broadly expressed in somatic cells, associate with miRNAs and are key actors in different RNA silencing pathways. However, only the Ago2 protein displays endonucleolytic or 'Slicer' activity and can therefore execute miRNA-directed cleavage of target mRNA, provided that the base-pairing between the Ago2-associated miRNA and the mRNA sequence is perfect. In case of partial complementarity, the Ago2 protein fails to cleave, but instead interferes with translation of the target mRNA via its translational repression activity. Ago2 has been shown to play a non-redundant role in small RNA guided gene silencing processes, including RNA interference, translation repression and heterochromatinization. As a core element of the RISC complex, AGO2 initiates the degradation of target mRNAs through its catalytic activity in gene silencing processes guided by siRNAs or miRNAs. In addition to mRNA degradation or gene silencing guided by miRNAs, Ago2 also acts as a RNA slicer in a Dicer-independent way, as well as a regulator of miRNA maturation. Over-expression of Ago2 has been correlated with several aspects of cancers, including tumor cell growth and the overall survival of cancer patients. Furthermore, gene disruption in the mouse demonstrated that the Ago2 protein is essential for embryonic development and a key regulator of B-lymphoid and erythroid development.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: AGO1; ARGONAUTE 2; argonaute 2, RISC catalytic component; Argonaute RISC catalytic component 2; Argonaute1; Argonaute2; argonaute2 {ECO:0000255|HAMAP-Rule:MF_03031}; AT1G31280; AtAGO2; cancer susceptibility candidate 7 (non-protein coding); eIF-2C 1; eIF-2C 2; eIF-2C 2 {ECO:0000255|HAMAP-Rule:MF_03031}; eIF2C; eIF2C 1; eIF2C 2 {ECO:0000255|HAMAP-Rule:MF_03031}; EIF2C1; Eukaryotic translation initiation factor 2C 2; eukaryotic translation initiation factor 2C 2 {ECO:0000255|HAMAP-Rule:MF_03031}; eukaryotic translation initiation factor 2C, 2; GERp95; golgi ER protein 95 kDa; hAgo1; LOC840016; long intergenic non-protein coding RNA 980; mAgo2; PAZ Piwi domain protein; Piwi/Argonaute family protein meIF2C2; PPD; Protein argonaute-1; Protein argonaute-2; Protein slicer; T19E23.7; T19E23_7

          View more View less

          Gene Aliases: 1110029L17Rik; 2310051F07Rik; AGO2; AI225898; AL022874; AW546247; CASC7; EIF2C2; ENSMUSG00000072493; Gerp95; Gm10365; Kiaa4215; LESKRES; LINC00980; mKIAA4215; PPD; Q10

          View more View less

          UniProt ID: (Human) Q9UKV8, (Mouse) Q8CJG0

          View more View less

          Entrez Gene ID: (Human) 27161, (Rat) 59117, (Mouse) 239528

          View more View less

          Function(s)
          RNA 7-methylguanosine cap binding RNA polymerase II core binding core promoter sequence-specific DNA binding nucleic acid binding RNA binding double-stranded RNA binding single-stranded RNA binding mRNA binding translation initiation factor activity nuclease activity endonuclease activity endoribonuclease activity protein binding hydrolase activity endoribonuclease activity, producing 5'-phosphomonoesters siRNA binding miRNA binding mRNA 3'-UTR AU-rich region binding metal ion binding endoribonuclease activity, cleaving siRNA-paired mRNA endoribonuclease activity, cleaving miRNA-paired mRNA mRNA cap binding molecular_function poly(A) RNA binding pre-miRNA binding core promoter binding translation initiation factor
          Process(es)
          regulation of transcription, DNA-templated translation translational initiation regulation of translation post-embryonic development gene expression miRNA metabolic process positive regulation of gene expression production of siRNA involved in RNA interference gene silencing by RNA pre-miRNA processing cytoplasmic mRNA processing body assembly posttranscriptional gene silencing by RNA production of miRNAs involved in gene silencing by miRNA miRNA mediated inhibition of translation mRNA cleavage involved in gene silencing by miRNA negative regulation of amyloid precursor protein biosynthetic process RNA stabilization positive regulation of translation positive regulation of angiogenesis positive regulation of transcription from RNA polymerase II promoter negative regulation of translational initiation positive regulation of nuclear-transcribed mRNA poly(A) tail shortening small RNA loading onto RISC regulation of synapse maturation mRNA cleavage involved in gene silencing by siRNA positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay positive regulation of trophoblast cell migration transcription, DNA-templated mRNA cleavage biological_process cell differentiation miRNA loading onto RISC involved in gene silencing by miRNA RNA phosphodiester bond hydrolysis, endonucleolytic multicellular organism development RNA secondary structure unwinding siRNA loading onto RISC involved in RNA interference
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          온라인 주문 Plus Icon Minus Icon
          • 주문 현황
          • 주문 지원
          • 빠른 주문
          • Supply Center
          • eProcurement
          지원 Plus Icon Minus Icon
          • Help and Support
          • 고객 센터
          • 기술 지원 센터
          • 제품 문서 검색
          • 사이트 문제 보고
          교육 및 이벤트 Plus Icon Minus Icon
          • 교육 센터
          • 프로모션
          • 이벤트 및 웨비나
          • 소셜 미디어
          About Thermo Fisher Plus Icon Minus Icon
          • 소개 소개
          • 채용 채용
          • 투자자 투자자
          • 뉴스 뉴스
          • 사회적 책임 사회적 책임
          • Trademarks
          • 공정거래 공정거래
          • 정책 및 고지
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • 이용 약관
          • 개인정보 처리방침
          • 가격 및 운임 정책
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Korea flag icon
          Korea

          고객센터 문의 | 평일 09:00~18:00
          1661-9555   |   Live Chat   |   카카오톡 상담

           

          장비 서비스 문의 | 평일 09:00~18:00
          1661-5055   |   Live Chat

          고객센터 문의 | 평일 09:00~18:00
          1661-9555   |   Live Chat   |   카카오톡 상담

           

          장비 서비스 문의 | 평일 09:00~18:00
          1661-5055   |   Live Chat

          고객센터 문의 | 평일 09:00~18:00
          1661-9555   |   Live Chat   |   카카오톡 상담

           

          장비 서비스 문의 | 평일 09:00~18:00
          1661-5055   |   Live Chat

          써모 피셔 사이언티픽 코리아 주식회사
          대표자 : 석수진
          사업자 등록번호 : 117-81-46910
          입금계좌 : 하나은행 336-890014-06204
          (예금주 : 써모피셔사이언티픽코리아 주식회사)

           

          써모 피셔 사이언티픽 솔루션스 유한회사
          대표자 : 석수진
          사업자 등록번호 : 114-86-04783
          입금계좌 : 신한은행 140-004-396660
          (예금주 : 써모피셔사이언티픽솔루션스 유한회사)

           

          주소 : 서울시 강남구 광평로 281 수서오피스빌딩 12층 06349 | 통신판매업신고번호 : 2015-서울강남-00898

          ISMS Logo

          Your items have has been added!


          Host server : magellan-search-blue-78576c459-fhm29:80/100.66.76.150:80.
          git-commit: 65c7ea78bfc366f1196f6925435a6e3b75c9e6fa
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.48.0-Offline