Hamburger Menu Button
Thermo Fisher Scientific Logo
Iniciar sesión
¿No tiene una cuenta? Crear una cuenta
  • Productos
    • Consumibles de laboratorio
    • Equipos de laboratorio
    • Instrumentos de Laboratorio
    • Clínica y Diagnóstico
    • Cromatografía
    • Espectrometría de Masas
    • Cultivo Celular
    • Análisis Celular
    • Anticuerpos
    • Ver todas las categorías de producto
  • Aplicaciones
    • Cultivo celular y transfección
    • Citometría de flujo
    • Investigación sobre el cáncer
    • Cromatografía
    • Secuenciación
    • PCR
    • Soluciones para laboratorio
    • Diagnóstico de alergias
    • Ver todas las aplicaciones y técnicas
  • Servicios
    • Servicios Personalizados
    • Servicios de Capacitación
    • Servicios para Empresas
    • Informática para laboratorios de ámbito empresarial
    • Servicios financieros y de arrendamiento
    • Servicios 360° de CDMO y CRO
    • Servicios de CDMO
    • Servicios de CRO
    • Inspección de seguridad alimentaria Servicios
    • Ver todos los servicios
  • Ayuda y Soporte
    • Crear una nueva cuenta
    • Cómo hacer el pedido
    • Póngase en contacto con nosotros
    • Cambio de ubicación
    • Ver toda la ayuda y soporte técnico
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Ofertas especiales
  • Contáctenos
  • Orden Rápida
  • Documentos y certificados
Thermo Fisher Scientific Logo

Search

Buscar
Search button
          • Contáctenos
          • Orden Rápida
          • Iniciar sesión
            Iniciar sesión
            ¿No tiene una cuenta? Crear una cuenta
            • Cuenta
            • Estatus del pedido
            • Productos personalizados y proyectos​

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • AGO2 Antibodies

          Invitrogen

          AGO2 Polyclonal Antibody

          View all (26) AGO2 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite AGO2 Polyclonal Antibody

          • Antibody Testing Data (1)
          AGO2 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          AGO2 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 1

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          AGO2 Antibody (PA5-78738) in WB

          Western blot analysis of AGO2 using AGO2 Polyclonal Antibody (Product # PA5-78738). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 µg of sample under reducing conditions. Lane 1: human Jurkat whole cell lysates. Lane 2: human 293T whole cell lysates. Lane 3: human K562 whole cell lysates. Lane 4: human MCF-7 whole cell lysates. Lane 5: rat lung tissue lysates. Lane 6: rat pancreas tissue lysates. Lane 7: mouse pancreas tissue lys... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          AGO2 Antibody in Western Blot (WB)
          AGO2 Polyclonal Antibody

          Product Details

          PA5-78738

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human Ago2/ eIF2C2 (129-169aa KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2745854

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human Jurkat whole cell, human 293T whole cell, human K562 whole cell, human MCF-7 whole cell, rat lung tissue, rat pancreas tissue, mouse pancreas tissue.

          Target Information

          Ago proteins are broadly expressed in somatic cells, associate with miRNAs and are key actors in different RNA silencing pathways. However, only the Ago2 protein displays endonucleolytic or 'Slicer' activity and can therefore execute miRNA-directed cleavage of target mRNA, provided that the base-pairing between the Ago2-associated miRNA and the mRNA sequence is perfect. In case of partial complementarity, the Ago2 protein fails to cleave, but instead interferes with translation of the target mRNA via its translational repression activity. Ago2 has been shown to play a non-redundant role in small RNA guided gene silencing processes, including RNA interference, translation repression and heterochromatinization. As a core element of the RISC complex, AGO2 initiates the degradation of target mRNAs through its catalytic activity in gene silencing processes guided by siRNAs or miRNAs. In addition to mRNA degradation or gene silencing guided by miRNAs, Ago2 also acts as a RNA slicer in a Dicer-independent way, as well as a regulator of miRNA maturation. Over-expression of Ago2 has been correlated with several aspects of cancers, including tumor cell growth and the overall survival of cancer patients. Furthermore, gene disruption in the mouse demonstrated that the Ago2 protein is essential for embryonic development and a key regulator of B-lymphoid and erythroid development.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: AGO1; argonaute 2; Argonaute RISC catalytic component 2; Argonaute1; Argonaute2; argonaute2 {ECO:0000255|HAMAP-Rule:MF_03031}; CTA-204B4.6; eIF-2C 1; eIF-2C 2; eIF-2C 2 {ECO:0000255|HAMAP-Rule:MF_03031}; eIF2C; eIF2C 1; eIF2C 2; eIF2C 2 {ECO:0000255|HAMAP-Rule:MF_03031}; EIF2C1; Eukaryotic translation initiation factor 2C 2; eukaryotic translation initiation factor 2C 2 {ECO:0000255|HAMAP-Rule:MF_03031}; eukaryotic translation initiation factor 2C, 2; GERp95; golgi ER protein 95 kDa; hAgo1; hAgo2; mAgo2; PAZ Piwi domain protein; Piwi/Argonaute family protein meIF2C2; PPD; Protein argonaute-1; Protein argonaute-2; Protein slicer

          View more View less

          Gene Aliases: 1110029L17Rik; 2310051F07Rik; AGO2; AI225898; AL022874; AW546247; EIF2C2; ENSMUSG00000072493; Gerp95; Gm10365; Kiaa4215; mKIAA4215; Q10

          View more View less

          UniProt ID: (Human) Q9UKV8, (Mouse) Q8CJG0

          View more View less

          Entrez Gene ID: (Human) 27161, (Rat) 59117, (Mouse) 239528

          View more View less

          Function(s)
          RNA 7-methylguanosine cap binding RNA polymerase II core binding core promoter binding double-stranded RNA binding single-stranded RNA binding mRNA binding translation initiation factor activity endoribonuclease activity protein binding protein C-terminus binding siRNA binding miRNA binding poly(A) RNA binding metal ion binding endoribonuclease activity, cleaving siRNA-paired mRNA endoribonuclease activity, cleaving miRNA-paired mRNA molecular_function RNA binding pre-miRNA binding nucleic acid binding nuclease activity endonuclease activity hydrolase activity translation initiation factor
          Process(es)
          transcription, DNA-templated translation translational initiation Wnt signaling pathway, calcium modulating pathway post-embryonic development RNA secondary structure unwinding miRNA metabolic process gene silencing by RNA pre-miRNA processing siRNA loading onto RISC involved in RNA interference posttranscriptional gene silencing by RNA production of miRNAs involved in gene silencing by miRNA miRNA mediated inhibition of translation mRNA cleavage involved in gene silencing by miRNA miRNA loading onto RISC involved in gene silencing by miRNA positive regulation of transcription from RNA polymerase II promoter negative regulation of translational initiation phosphatidylinositol-mediated signaling positive regulation of nuclear-transcribed mRNA poly(A) tail shortening RNA phosphodiester bond hydrolysis, endonucleolytic mRNA cleavage involved in gene silencing by siRNA positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay regulation of transcription, DNA-templated mRNA cleavage biological_process positive regulation of gene expression cell differentiation regulation of translation multicellular organism development
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Pedidos Plus Icon Minus Icon
          • Estatus del pedido
          • Ayuda para pedidos
          • Orden Rápida
          • Supply Center
          • eProcurement
          Soporte Plus Icon Minus Icon
          • Ayuda y soporte
          • Entre en Contacto
          • Centros de asistencia técnica
          • Consultar documentos y certificados
          • Informar de un problema en la web
          Recursos Plus Icon Minus Icon
          • Centros de aprendizaje
          • Promociones
          • Eventos & Webinars
          • Medios Sociales
          Acerca de Thermo Fisher Plus Icon Minus Icon
          • Acerca de nosotros Acerca de nosotros
          • Empleo Empleo
          • Inversores Inversores
          • Noticias Noticias
          • Responsabilidad social Responsabilidad social
          • Marcas comerciales
          • Políticas y avisos
          Nuestro Portafolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          México flag icon
          México

          Your items have has been added!


          Host server : magellan-search-blue-55ff9ddd88-grg9n:80/100.66.73.65:80.
          git-commit: d366ff9721d93504b2ac26a183b2b3e3d0e7d9ec
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.42.0-2026.01.03-1.0