A synthetic peptide corresponding to a sequence at the N-terminus of human Ago2/ eIF2C2 (129-169aa KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL), identical to the related mouse and rat sequences.
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
Ago proteins are broadly expressed in somatic cells, associate with miRNAs and are key actors in different RNA silencing pathways. However, only the Ago2 protein displays endonucleolytic or “Slicer” activity and can therefore execute miRNA-directed cleavage of target mRNA, provided that the base-pairing between the Ago2-associated miRNA and the mRNA sequence is perfect. In case of partial complementarity, the Ago2 protein fails to cleave, but instead interferes with translation of the target mRNA via its translational repression activity. Ago2 has been shown to play a non-redundant role in small RNA guided gene silencing processes, including RNA interference, translation repression and heterochromatinization. As a core element of the RISC complex, AGO2 initiates the degradation of target mRNAs through its catalytic activity in gene silencing processes guided by siRNAs or miRNAs. In addition to mRNA degradation or gene silencing guided by miRNAs, Ago2 also acts as a RNA slicer in a Dicer-independent way, as well as a regulator of miRNA maturation. Over-expression of Ago2 has been correlated with several aspects of cancers, including tumor cell growth and the overall survival of cancer patients. Furthermore, gene disruption in the mouse demonstrated that the Ago2 protein is essential for embryonic development and a key regulator of B-lymphoid and erythroid development.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: AGO1; argonaute 2; Argonaute RISC catalytic component 2; Argonaute2; argonaute2 {ECO:0000255|HAMAP-Rule:MF_03031}; CTA-204B4.6; eIF-2C 2; eIF-2C 2 {ECO:0000255|HAMAP-Rule:MF_03031}; eIF2C; eIF2C 1; eIF2C 2; eIF2C 2 {ECO:0000255|HAMAP-Rule:MF_03031}; EIF2C1; Eukaryotic translation initiation factor 2C 2; eukaryotic translation initiation factor 2C 2 {ECO:0000255|HAMAP-Rule:MF_03031}; eukaryotic translation initiation factor 2C, 2; GERp95; Golgi ER protein 95 kDa; hAgo1; hAgo2; mAgo2; PAZ Piwi domain protein; Piwi/Argonaute family protein meIF2C2; PPD; Protein argonaute-2; Protein slicer
Gene Aliases: 1110029L17Rik; 2310051F07Rik; AGO2; AI225898; AL022874; AW546247; EIF2C2; ENSMUSG00000072493; Gerp95; Gm10365; Kiaa4215; mKIAA4215; Q10
UniProt ID: (Human) Q9UKV8, (Rat) Q9QZ81, (Mouse) Q8CJG0
Entrez Gene ID: (Human) 27161, (Rat) 59117, (Mouse) 239528
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support