Search
Invitrogen
ARHGEF1 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 5
ARHGEF1 Antibody (PA5-78821) in ICC/IF
Immunocytochemistry analysis of ARHGEF1 using anti-ARHGEF1 antibody (Product # PA5-78821). ARHGEF1 was detected in a section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-ARHGEF1 antibody (Product # PA5-78821) overnight at 4°C. Cy3 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Vi... View More
Product Details
PA5-78821
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ARHGEF1 (41-71aa EQNSQFQSLEQVKRRPAHLMALLQHVALQFE).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat brain tissue, HELA whole cell, JURKAT whole cell. IHC: mouse lymphaden tissue, rat lymphaden tissue. ICC/IF: A431 cell. Flow: A431 cell.
Target Information
The Ras superfamily of GTPases, which can be subdivided into the Ras, Rho/Rac, Sar, Rab, ARF and Ran subfamilies, controls multiple aspects of cell function, including cytoskeletal rearrangement, nuclear signaling and cell growth. The Ras superfamily of GTPases function as regulated switches that toggle between a biologically active GTP-bound and an inactive GDP-bound form. This activation is catalyzed by guanine nucleotide exchange factors (GEFs). The Dbl-related proteins are a large family of structurally related molecules that have a common ability to catalyze GEF activity for specific members of the Ras family. Dbl-related proteins include FGD1, Lsc, RhoGEF p115, Lfc, Lbc and Brx. Lsc, Lbc and Lfc share sequence homology and show exchange activity toward Rho family GTPases. RhoGEF p115 catalyzes GEF activity for Rho but not Rac, Cdc42 or Ras GTPases.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 115 kDa guanine nucleotide exchange factor; 115-kD protein; Lbc's second cousin; Lsc homolog; lymphoid blast crisis like 2; Lymphoid blast crisis-like 2; p115-RhoGEF; p115RhoGEF; Rho guanine nucleotide exchange factor (GEF) 1; Rho guanine nucleotide exchange factor 1; Sub1.5
Gene Aliases: ARHGEF1; GEF1; IMD62; LBCL2; LSC; P115-RHOGEF; SUB1.5
UniProt ID: (Human) Q92888, (Mouse) Q61210
Entrez Gene ID: (Human) 9138, (Mouse) 16801, (Rat) 60323
G-protein coupled receptor signaling pathway
Rho protein signal transduction
regulation of small GTPase mediated signal transduction
Rho-activating G protein-coupled receptor signaling pathway
regulation of Rho protein signal transduction
termination of G-protein coupled receptor signaling pathway
negative regulation of cell death
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support