Search
Fabgennix
Adenine Nucleotide Translocator 2 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
ANT2-201AP
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
Synthetic peptide taken within amino acid region 150-200 on human ADP/ATP translocase 2.Sequence:AEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAK
Conjugate
Form
Liquid
Concentration
0.5-1.5 mg/mL
Purification
Affinity chromatography
Storage buffer
proprietary buffer, pH 7.4-7.8, with 0.5% BSA, 30% glycerol
Contains
0.02% sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
Target Information
Adenine nucleotide translocator (ANT) and the voltage-dependent anion-selective channel proteins 1 and 2 (VDAC1 and VDAC2) are components of the permeability transition pore complex (PTPC) of the mitochondrial inner and outer membranes, respectively. Formation of PTPCs, the subsequent dissipation of mitochondrial inner membrane potential and release of cytochrome c through the outer mitochondrial membrane are critical events in the early stages of apoptosis. Bax, a proapoptotic protein, has been shown to act upon ANT to induce the dissipation of mitochondrial inner membrane potential. ANT1 has a role in the maintenance of mitochondrial DNA by catalyzing the exchange of ADP and ATP across the mitochondrial inner membrane.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Adenine nucleotid translocator 2 fibroblast isoform (ATP-ADP carrier protein); Adenine nucleotid translocator 2, fibroblast isoform (ATP-ADP carrier protein); Adenine nucleotide translocator 2; adenine nucleotide translocator 2 (fibroblast); adenine nucleotide translocator 2 fibroblast isoform (ATP-ADP carrier protein); adenine nucleotide translocator 2, fibroblast isoform (ATP-ADP carrier protein); ADP,ATP carrier protein 2; ADP,ATP carrier protein, fibroblast isoform; ADP.ATP translocase; ADP/ATP carrier protein; ADP/ATP translocase 2; ANT 2; solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5; Solute carrier family 25 member 5; unnamed protein product
Gene Aliases: 2F1; AAC2; ANT2; SLC25A5; T2; T3
UniProt ID: (Human) P05141, (Rat) Q09073, (Mouse) P51881
Entrez Gene ID: (Human) 292, (Rat) 25176, (Mouse) 11740
adenine nucleotide transmembrane transporter activity
RNA binding
ATP:ADP antiporter activity
protein binding
hydrogen ion transmembrane transporter activity
adenine transmembrane transporter activity
antiporter activity
oxidative phosphorylation uncoupler activity
ubiquitin protein ligase binding
transporter activity
poly(A) RNA binding
transfer/carrier protein
chromosome segregation
positive regulation of cell proliferation
adenine transport
B cell differentiation
erythrocyte differentiation
regulation of mitochondrial membrane permeability
adenine nucleotide transport
transmembrane transport
mitochondrial ADP transmembrane transport
negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway
positive regulation of mitophagy
hydrogen ion transmembrane transport
mitochondrial ATP transmembrane transport
cellular response to leukemia inhibitory factor
adaptive thermogenesis
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support