Search

  • Order Status
  • Quick Order

Invitrogen

Bcl-X Polyclonal Antibody

View all (40) BCL-X antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Additional Information:
{{banner.description}}
{{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
Bcl-X Polyclonal Antibody

Product Details

PA5-95348

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-

Immunohistochemistry (Frozen) (IHC (F))

0.5-1 µg/mL
-

Immunocytochemistry (ICC/IF)

0.5-1 µg/mL
-

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells
-
Product Specifications

Species Reactivity

Human

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human Bcl-X (75-105aa LDAREVIPMAAVKQALREAGDEFELRYRRAF).
3D Epitope / Immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Amount

100 µg

Purification

Affinity chromatography

Storage buffer

PBS with 5mg BSA

Contains

0.05mg sodium azide

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2807151

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: SW620 whole cell. Flow: PC-3 cell, A549 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Target Information

The protein encoded the BCL-X gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Alternative splicing results in multiple transcript variants encoding two different isoforms. The longer isoform acts as an apoptotic inhibitor and the shorter isoform acts as an apoptotic activator.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: Apoptosis regulator Bcl-X; Bcl 2 like 1; bcl x; Bcl xL; BCL XL/S; bcl-2 L1; Bcl-2-like protein 1; bcl-xL; bcl-xS; Bcl2-L-1; BCLX; BclxL; BclXS; DKFZp781P2092; protein phosphatase 1, regulatory subunit 52; RP5-857M17.3; unnamed protein product

View more View less

Gene Aliases: Bcl-X; BCL-XL/S; BCL2L; BCL2L1; BCLX; PPP1R52

View more View less

UniProt ID: (Human) Q07817

View more View less

Entrez Gene ID: (Human) 598

View more View less

Function(s)
protein binding channel activity protein kinase binding identical protein binding BH3 domain binding
Process(es)
ovarian follicle development in utero embryonic development release of cytochrome c from mitochondria endocytosis apoptotic process response to stress mitochondrion organization germ cell development spermatogenesis male gonad development intrinsic apoptotic signaling pathway in response to DNA damage apoptotic mitochondrial changes response to radiation fertilization response to virus negative regulation of autophagy regulation of cytokinesis positive regulation of mononuclear cell proliferation response to cytokine ectopic germ cell programmed cell death regulation of growth regulation of apoptotic process positive regulation of apoptotic process negative regulation of apoptotic process negative regulation of neuron apoptotic process dendritic cell proliferation response to cycloheximide regulation of mitochondrial membrane permeability epithelial cell proliferation negative regulation of developmental process neuron apoptotic process defense response to virus response to other organism regulation of mitochondrial membrane potential transmembrane transport cellular response to amino acid stimulus cellular response to alkaloid cellular response to gamma radiation apoptotic process in bone marrow negative regulation of release of cytochrome c from mitochondria dendritic cell apoptotic process extrinsic apoptotic signaling pathway in absence of ligand hepatocyte apoptotic process negative regulation of execution phase of apoptosis negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway negative regulation of extrinsic apoptotic signaling pathway via death domain receptors negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway regulation of intracellular signal transduction negative regulation of protein localization to plasma membrane negative regulation of reproductive process negative regulation of dendritic cell apoptotic process negative regulation of anoikis regulation of apoptotic signaling pathway negative regulation of extrinsic apoptotic signaling pathway in absence of ligand negative regulation of intrinsic apoptotic signaling pathway
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support