Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Promotions
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central
          • Primary Antibodies ›
          • CD36 Antibodies

          Invitrogen

          CD36 Polyclonal Antibody

          View all (105) CD36 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite CD36 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (3)
          CD36 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          CD36 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 3

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          CD36 Antibody (PA5-95242) in IHC (P)

          Immunohistochemical analysis of Galectin 1 in paraffin-embedded section of human Lung cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/mL rabbit anti-Galectin 1 antibody (Product # PA5-95242) overnight at 4°C. Biotinylated goat anti-... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          CD36 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          CD36 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          CD36 Antibody in Western Blot (WB)
          CD36 Polyclonal Antibody

          Product Details

          PA5-95242

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human CD36 (31-66aa DLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFW).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807046

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: Rat Liver Tissue, Rat Cardiac Muscle Tissue, Mouse Liver Tissue, Mouse Cardiac Muscle Tissue, SMMC whole cell. IHC: Rat Spleen Tissue, human Lung cancer tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          CD36, also known as scavenger receptor class B member 3, is a protein that is expressed on the surface of various cell types, including macrophages, platelets, and adipocytes. It plays a role in lipid metabolism, inflammation, and atherosclerosis, and is involved in the recognition and uptake of various ligands such as oxidized low-density lipoproteins, long-chain fatty acids, and apoptotic cells. CD36 is also implicated in the pathogenesis of malaria. The protein encoded by this gene serves as a receptor for thrombospondin in platelets and various cell lines, and is the fourth major glycoprotein of the platelet surface. It binds to collagen, thrombospondin, anionic phospholipids, and oxidized LDL, and directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants have been found for this gene. Diseases associated with CD36 include Platelet Glycoprotein IV Deficiency and Coronary Heart Disease 7.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: 85 kda protein; 88 kda cell surface glycoprotein; adipocyte membrane protein; CD36; CD36 antigen; CD36 antigen (collagen type I receptor, thrombospondin receptor); CD36 molecule (CD36 blood group) transcript; CD36 molecule (thrombospondin receptor); CD36 molecule (thrombospondin receptor) isoform CD36_1; CD36 molecule (thrombospondin receptor) isoform CD36_2; CD36 molecule (thrombospondin receptor) isoform CD36_3; cluster determinant 36; collagen type I receptor thrombospondin receptor; FAT; Fatty acid translocase; fatty acid transport protein; glycoprotein GPIIIb/GPIV; Glycoprotein IIIb; GPIIIB; GPIV; Leukocyte differentiation antigen CD36; PAS IV; PAS-4; PAS-4 protein; Platelet collagen receptor; Platelet glycoprotein 4; Platelet glycoprotein IV; scavenger receptor class B, member 3; SR-B3; Thrombospondin receptor; unnamed protein product

          View more View less

          Gene Aliases: BDPLT10; CD36; CHDS7; FAT; GP3B; GP4; GPIV; PASIV; SCARB3

          View more View less

          UniProt ID: (Human) P16671, (Mouse) Q08857

          View more View less

          Entrez Gene ID: (Human) 948, (Rat) 29184, (Mouse) 12491

          View more View less

          Function(s)
          beta-amyloid binding low-density lipoprotein receptor activity scavenger receptor activity long-chain fatty acid transporter activity protein binding high-density lipoprotein particle binding lipid binding short-chain fatty acid uptake transporter activity low-density lipoprotein particle binding Toll-like receptor binding cargo receptor activity macromolecular complex binding transforming growth factor beta binding thrombospondin receptor activity lipoteichoic acid receptor activity lipoprotein particle binding oxidised low-density lipoprotein particle receptor activity oleate transmembrane transporter activity oleic acid binding membrane trafficking regulatory protein
          Process(es)
          negative regulation of transcription from RNA polymerase II promoter MAPK cascade positive regulation of cell-matrix adhesion production of molecular mediator involved in inflammatory response lipid metabolic process fatty acid metabolic process lipid transport receptor-mediated endocytosis phagocytosis, recognition phagocytosis, engulfment cell adhesion cell surface receptor signaling pathway positive regulation of cytosolic calcium ion concentration blood coagulation response to bacterium positive regulation of gene expression negative regulation of gene expression positive regulation of macrophage derived foam cell differentiation positive regulation of cholesterol storage fatty acid transport long-chain fatty acid transport plasma membrane long-chain fatty acid transport short-chain fatty acid transport negative regulation of angiogenesis lipid storage cGMP-mediated signaling positive regulation of blood coagulation intestinal cholesterol absorption cholesterol transport receptor internalization regulation of lipopolysaccharide-mediated signaling pathway positive regulation of interleukin-1 beta production positive regulation of interleukin-12 production positive regulation of interleukin-6 production positive regulation of tumor necrosis factor production response to lipid regulation of toll-like receptor signaling pathway triglyceride transport plasma lipoprotein particle clearance low-density lipoprotein particle clearance cellular response to oxidative stress response to stilbenoid nitric oxide-cGMP-mediated signaling pathway negative regulation of protein import into nucleus lipoprotein transport positive regulation of I-kappaB kinase/NF-kappaB signaling regulation of protein complex assembly apoptotic cell clearance positive regulation of MAPK cascade long-chain fatty acid import positive regulation of nitric oxide biosynthetic process positive regulation of angiogenesis defense response to Gram-positive bacterium intestinal absorption sensory perception of taste low-density lipoprotein particle mediated signaling positive regulation of phagocytosis, engulfment positive regulation of macrophage cytokine production positive regulation of ERK1 and ERK2 cascade cholesterol import response to fatty acid response to linoleic acid cellular response to bacterial lipopeptide cellular response to lipopolysaccharide cellular response to lipoteichoic acid cellular response to low-density lipoprotein particle stimulus cellular response to hydroperoxide cellular response to diacyl bacterial lipopeptide energy homeostasis regulation of action potential positive regulation of cold-induced thermogenesis cellular response to oxidised low-density lipoprotein particle stimulus oxidised low-density lipoprotein particle clearance amyloid-beta clearance by cellular catabolic process positive regulation of NLRP3 inflammasome complex assembly positive regulation of protein localization to plasma membrane positive regulation of reactive oxygen species biosynthetic process cellular response to beta-amyloid amyloid fibril formation lipid transport across blood brain barrier regulation of removal of superoxide radicals positive regulation of blood microparticle formation positive regulation of reactive oxygen species metabolic process long-chain fatty acid metabolic process pattern recognition receptor signaling pathway negative regulation of systemic arterial blood pressure triglyceride metabolic process signal transduction nitric oxide mediated signal transduction response to nutrient response to mechanical stimulus response to activity fatty acid oxidation response to estradiol cellular response to insulin stimulus response to drug negative regulation of transcription factor import into nucleus negative regulation of growth of symbiont in host digestive tract development positive regulation of cytokine secretion positive regulation of peptidyl-tyrosine phosphorylation response to growth hormone transport regulation of transcription from RNA polymerase II promoter in response to oxidative stress
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          France flag icon
          France

          Your items have has been added!


          Host server : magellan-search-blue-67655d8755-zsnhf:80/100.66.75.14:80.
          git-commit: dddaa802cd395f65bf1581942d0e97a089c38f41
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.46.0-Offline