Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
0.5-1 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the N-terminus of human CD36, different from the related mouse sequence by six amino acids, and from the related rat sequence by four amino acids. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2807046 |
Synthetic peptide sequence: 31-66aa, DLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFW.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
CD36 (fatty acid translocase, FAT) is an 88 kDa, ditopic glycosylated protein that belongs to the class B family of scavenger receptors. CD36 is expressed by most resting marginal zone B cells but not by follicular and B1 B cells, and is rapidly induced on Follicular B cells in vitro upon TLR and CD40 stimulation. CD36 does not affect the development of B cells, but modulates both primary and secondary antibody response. Similar to glucose transporter GLUT4, CD36 is translocated from intracellular pools to the plasma membrane following cell stimulation by insulin. In mouse, CD36 is responsible for gustatory perception of long-chain fatty acids. CD36 is preferentially found within lipid rafts, which facilitates its association with receptors, signaling and adapter molecules. CD36 binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. Further, CD36 may function as a cell adhesion molecule and directly mediates cyto-adherence of Plasmodium falciparum parasitized erythrocytes. Mutations in the CD36 gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants encoding the CD36 protein have been found.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: adipocyte membrane protein; CD36; CD36 antigen (collagen type I receptor, thrombospondin receptor); CD36 molecule (thrombospondin receptor); cluster determinant 36; collagen type I receptor thrombospondin receptor; FAT; Fatty acid translocase; fatty acid transport protein; Glycoprotein IIIb; GPIIIB; GPIV; Leukocyte differentiation antigen CD36; PAS IV; PAS-4; PAS-4 protein; Platelet collagen receptor; Platelet glycoprotein 4; Platelet glycoprotein IV; scavenger receptor class B, member 3; SR-B3; Thrombospondin receptor
Gene Aliases: BDPLT10; CD36; CHDS7; FAT; GP3B; GP4; GPIV; PASIV; SCARB3
UniProt ID: (Human) P16671, (Mouse) Q08857
Entrez Gene ID: (Human) 948, (Rat) 29184, (Mouse) 12491
Molecular Function:
membrane trafficking regulatory protein
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support