Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Promotions
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central
          • Primary Antibodies ›
          • CK1 alpha Antibodies

          Invitrogen

          CK1 alpha Polyclonal Antibody

          View all (23) CK1 alpha antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers

          Cite CK1 alpha Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (4)
          CK1 alpha Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          CK1 alpha Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 4

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          CK1 alpha Antibody (PA5-79077) in IHC (P)

          Immunohistochemistry analysis of CK1 alpha on paraffin-embedded human intestinal cancer tissue. Sample was incubated with CK1 alpha polyclonal antibody (Product# PA5-79077). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          CK1 alpha Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          CK1 alpha Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          CK1 alpha Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          CK1 alpha Antibody in Western Blot (WB)
          CK1 alpha Polyclonal Antibody

          Product Details

          PA5-79077

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human CSNK1A1 (30-68aa DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746193

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: Rat Brain Tissue, Rat Kidney Tissue, Mouse Kidney Tissue, HELA whole cell. IHC: mouse intestine tissue, rat intestine tissue, human intestinal cancer tissue.

          Target Information

          CNSK1A1 (CK1 alpha 1) is a member of the casein kinase I (CKI) gene family, which encodes serine/threonine kinases that preferentially phosphorylate acidic substrates. CKI proteins are monomeric, ranging from 25 to 55 kD, and are found in the nuclei, cytoplasm, and membrane fractions of eukaryotic cells. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Phosphorylates CTNNB1 at 'Ser-45'. May phosphorylate PER1 and PER2. May play a role in segregating chromosomes during mitosis.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: Casein kinase I isoform alpha; casein kinase I-alpha; CK I alpha; CK-I alpha; CK1; CKI alpha; CKI-alpha; clock regulator kinase; CSNK1A1; CSNK1A1/CK1; down-regulated in lung cancer; epididymis secretory sperm binding protein Li 77p; OTTHUMP00000224000; OTTHUMP00000224001; OTTHUMP00000224003; unnamed protein product; YIL035C

          View more View less

          Gene Aliases: 2610208K14Rik; 4632404G05Rik; 5430427P18Rik; CK1; CK1a; CKIa; Csnk1a; CSNK1A1; HEL-S-77p; HLCDGP1; PRO2975

          View more View less

          UniProt ID: (Human) P48729, (Rat) P97633, (Mouse) Q8BK63

          View more View less

          Entrez Gene ID: (Human) 1452, (Rat) 113927, (Mouse) 93687

          View more View less

          Function(s)
          nucleotide binding protein kinase activity protein serine/threonine kinase activity protein binding ATP binding kinase activity transferase activity protein serine kinase activity magnesium ion binding glycoprotein binding peptide binding phosphoprotein binding transferase activity, transferring phosphorus-containing groups non-receptor serine/threonine protein kinase
          Process(es)
          autophagosome assembly protein phosphorylation Golgi organization signal transduction cell surface receptor signaling pathway negative regulation of autophagy positive regulation of autophagy Wnt signaling pathway viral protein processing regulation of Wnt signaling pathway SCF-dependent proteasomal ubiquitin-dependent protein catabolic process cellular response to nutrient levels cellular response to nutrient positive regulation of proteasomal ubiquitin-dependent protein catabolic process positive regulation of Rho protein signal transduction TORC1 signaling proteasome-mediated ubiquitin-dependent protein catabolic process NLRP3 inflammasome complex assembly intermediate filament cytoskeleton organization cell division negative regulation of canonical Wnt signaling pathway negative regulation of NLRP3 inflammasome complex assembly positive regulation of NLRP3 inflammasome complex assembly negative regulation of TORC1 signaling positive regulation of TORC1 signaling cell morphogenesis phagocytosis mitotic nuclear division regulation of cell shape peptidyl-serine phosphorylation cell cycle phosphorylation
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy Consumer Health Data Privacy Policy
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Notice
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-n9r8p:80/100.66.76.150:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline