Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
0.5-1 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the C-terminus of human CYP17A1, different from the related mouse and rat sequences by ten amino acids. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 4mg trehalose |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2807196 |
Synthetic peptide sequence: 383-419aa, EFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLN.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. It has both 17alpha-hydroxylase and 17,20-lyase activities and is a key enzyme in the steroidogenic pathway that produces progestins, mineralocorticoids, glucocorticoids, androgens, and estrogens. Mutations in this gene are associated with isolated steroid-17 alpha-hydroxylase deficiency, 17-alpha-hydroxylase/17,20-lyase deficiency, pseudohermaphroditism, and adrenal hyperplasia.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: 17-alpha-hydroxyprogesterone aldolase; 17a-hydroxylase; CYPXVII; Cytochrome P450 17A1; cytochrome p450 XVIIA1; cytochrome P450, family 17, subfamily A, polypeptide 1; cytochrome P450, subfamily XVII (steroid 17-alpha-hydroxylase), adrenal hyperplasia; Cytochrome P450-C17; Cytochrome P450c17; HGNC:2593; Steroid 17-alpha-hydroxylase/17,20 lyase; Steroid 17-alpha-monooxygenase
Gene Aliases: CPT7; CYP17; CYP17A1; P450C17; S17AH
UniProt ID: (Human) P05093
Entrez Gene ID: (Human) 1586
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support