Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
PA5-95393
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human CYP17A1 (383-419aa EFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLN).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.01mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2807196
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human SH-SY5Y whole cell, human HepG2 whole cell, human Hela whole cell, human Jurkat whole cell, rat testis tissue. IHC: human testis tissue. Flow: U87 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. It has both 17alpha-hydroxylase and 17,20-lyase activities and is a key enzyme in the steroidogenic pathway that produces progestins, mineralocorticoids, glucocorticoids, androgens, and estrogens. Mutations in this gene are associated with isolated steroid-17 alpha-hydroxylase deficiency, 17-alpha-hydroxylase/17,20-lyase deficiency, pseudohermaphroditism, and adrenal hyperplasia.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 17-alpha-hydroxyprogesterone aldolase; 17a-hydroxylase; CYPXVII; Cytochrome P450 17A1; cytochrome p450 XVIIA1; cytochrome P450, family 17, subfamily A, polypeptide 1; cytochrome P450, subfamily 17; Cytochrome P450, subfamily XVII; cytochrome P450, subfamily XVII (steroid 17-alpha-hydroxylase), adrenal hyperplasia; Cytochrome P450-C17; Cytochrome P450c17; HGNC:2593; P450-C17; P45017alpha; P450c17; Steroid 17-alpha-hydroxylase/17,20 lyase; Steroid 17-alpha-monooxygenase
Gene Aliases: CPT7; CYP17; CYP17A1; P450C17; S17AH
UniProt ID: (Human) P05093, (Rat) P11715
Entrez Gene ID: (Human) 1586, (Rat) 25146
steroid biosynthetic process
androgen biosynthetic process
glucocorticoid biosynthetic process
sex differentiation
steroid metabolic process
response to herbicide
response to acetate
response to ionizing radiation
sterol metabolic process
response to insecticide
biphenyl metabolic process
dibenzo-p-dioxin metabolic process
phenol-containing compound metabolic process
phthalate metabolic process
hippocampus development
adrenal gland development
ovulation
response to nutrient levels
response to retinoic acid
Leydig cell differentiation
response to cytokine
hormone biosynthetic process
progesterone metabolic process
response to drug
response to steroid hormone
response to cAMP
response to methylmercury
oxidation-reduction process
response to fungicide
cellular response to lipopolysaccharide
cellular response to antibiotic
cellular response to gonadotropin stimulus
positive regulation of steroid hormone biosynthetic process
organic acid metabolic process
male gonad development
response to toxic substance
response to organic substance
response to organic cyclic compound
response to gonadotropin
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support