Invitrogen

Calpastatin Polyclonal Antibody

Product Image Gallery

Calpastatin Antibody in Immunohistochemistry (Paraffin) (IHC (P)) — Immunohistochemistry analysis of Calpastatin on paraffin-embedded human intestinal cancer tissue. Antigen retrieval was performed using citrate buffer (pH6, epitope retrieval solution) for 20 mins. Sample was blocked using 10% goat serum, incubated with Calpastatin polyclonal antibody (Product# PA5-78925) with a dilution of 1 µg/mL (overnight at 4°C), and followed by biotinylated goat anti-rabbit IgG (30 minutes at 37°C). Development was performed using Streptavidin-Biotin-Complex (SABC) with DAB chromogen method.

Calpastatin Antibody in Western Blot (WB) — Western blot analysis of Calpastatin in Lane 1: COLO320 whole cell lysate using 50 µg (reducing conditions) per well. Electrophoresis was performed on 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours and protein was transferred to a nitrocellulose membrane at 150mA for 50-90 minutes. Sample was blocked with 5% Non-fat Milk/TBS for 1.5 hours at room temperature, incubated with Calpastatin polyclonal antibody (Product # PA5-78925) at a dilution of 0.5 µg/mL (overnight at 4°C), followed by goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10,000. Signal development was performed using a chemiluminescence (ECL) kit.

Product Details

Tested Applications

Dilution

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells

Immunocytochemistry (ICC)

0.5-1 µg/mL

Immunofluorescence (IF)

0.5-1 µg/mL

Immunohistochemistry (Frozen) (IHC (F))

0.5-1 µg/mL

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL

Western Blot (WB)

0.1-0.5 µg/mL

Product Specifications

Species Reactivity

Human

Host / Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human Calpastatin.

Conjugate

Unconjugated

Form

Lyophilized

Purification

Antigen affinity chromatography

Storage buffer

PBS with 5mg BSA

Contains

0.05mg sodium azide

Storage conditions

-20°C

RRID

AB_2746041

Product Specific Information

The synthetic peptide sequence is 275-310aa, QEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLR

Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.

Target Information

The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The encoded protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins. Alternatively spliced transcript variants encoding different isoforms have been described.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.