Product Specifications | |
---|---|
Species Reactivity |
Human |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence in the middle region of human Calpastatin. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
-20°C |
RRID |
AB_2746041 |
The synthetic peptide sequence is 275-310aa, QEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLR
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
Calpastatin is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: Calpain inhibitor; Calpastatin; Sperm BS-17 component
Gene Aliases: BS-17; CAST; PLACK
UniProt ID: (Human) P20810
Entrez Gene ID: (Human) 831
Molecular Function:
protein-binding activity modulator
protease inhibitor
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support