Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
DDAH2 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 5
DDAH2 Antibody (PA5-79141) in ICC/IF
Immunocytochemistry analysis of DDAH2 using anti-DDAH2 antibody (Product # PA5-79141). DDAH2 was detected in a section of U2OS cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-DDAH2 antibody (Product # PA5-79141)overnight at 4°C. DyLight®550 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Vis... View More
Product Details
PA5-79141
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH2 (190-224aa DAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat lung tissue, mouse lung tissue, human placenta tissue. IHC: human lung cancer tissue, human placenta tissue. ICC/IF: U20S cell. Flow: CACO-2 cell.
Target Information
This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Clone 7u; DADB-110M10.5; DDAH-2; DDAHII; dimethylargininase-2; dimethylarginine dimethylaminohydrolase II; epididymis secretory protein Li 277; Inactive N(G),N(G)-dimethylarginine dimethylaminohydrolase 2; N(G),N(G)-dimethylarginine dimethylaminohydrolase 2; OTTHUMP00000029307; OTTHUMP00000062666; OTTHUMP00000174406; Protein G6a; Putative hydrolase DDAH2; S-phase protein; testis tissue sperm-binding protein Li 54e
Gene Aliases: 1110003M04Rik; AU019324; AW413173; DDAH; DDAH-2; DDAH2; DDAHII; G6A; HEL-S-277; NG30
UniProt ID: (Human) O95865, (Mouse) Q99LD8, (Rat) Q6MG60
Entrez Gene ID: (Human) 23564, (Mouse) 51793, (Rat) 294239
citrulline metabolic process
arginine catabolic process
nitric oxide biosynthetic process
nitric oxide mediated signal transduction
negative regulation of apoptotic process
positive regulation of nitric oxide biosynthetic process
regulation of nitric-oxide synthase activity
arginine metabolic process
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support