Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
0.5-1 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH2. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
-20°C |
RRID |
AB_2746257 |
The synthetic peptide sequence is 190-224aa, DAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: Clone 7u; DADB-110M10.5; DDAH-2; DDAHII; Dimethylargininase-2; dimethylarginine dimethylaminohydrolase II; epididymis secretory protein Li 277; N(G),N(G)-dimethylarginine dimethylaminohydrolase 2; OTTHUMP00000029307; OTTHUMP00000062666; OTTHUMP00000174406; Protein G6a; S-phase protein; testis tissue sperm-binding protein Li 54e
Gene Aliases: 1110003M04Rik; AU019324; AW413173; DDAH; DDAH-2; DDAH2; DDAHII; G6A; HEL-S-277; NG30
UniProt ID: (Human) O95865, (Mouse) Q99LD8, (Rat) Q6MG60
Entrez Gene ID: (Human) 23564, (Mouse) 51793, (Rat) 294239
Molecular Function:
hydrolase
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support