Invitrogen
This Antibody was verified by Cell treatment to ensure that the antibody binds to the antigen stated.
Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
0.5-1 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Non-human primate, Rat |
Host/Isotype |
Mouse / IgG2a |
Class |
Monoclonal |
Type |
Antibody |
Clone |
9D8 |
Immunogen |
A synthetic peptide corresponding to a sequence of human FH. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 4mg trehalose |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2802644 |
Synthetic peptide sequence: YDKAAKIAKTAH KNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
The protein encoded by this gene is an enzymatic component of the tricarboxylic acid cycle, or Krebs cycle, and catalyzes the formation of L-malate from fumarate. It exists in both a cytosolic form and an N-terminal extended form, differing only in the translation start site used. The N-terminal extended form is targeted to the mitochondrion, where the removal of the extension generates the same form as in the cytoplasm. It is similar to some thermostable class II fumarases and functions as a homotetramer. Mutations in this gene can cause fumarase deficiency and lead to progressive encephalopathy.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: EF-3; Fumarase; fumarate hydratase 1; Fumarate hydratase, mitochondrial
Gene Aliases: FH; Fh-1; Fh1; FMRD; HLRCC; LRCC; MCL; MCUL1
UniProt ID: (Human) P07954, (Rat) P14408, (Mouse) P97807
Entrez Gene ID: (Human) 2271, (Rat) 24368, (Mouse) 14194
Molecular Function:
lyase
metabolite interconversion enzyme
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support