Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | View 1 publication 1 publication |
Immunohistochemistry (Paraffin) (IHC (P)) |
0.5-1 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Published species |
Human |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the N-terminus of human GNAQ. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
-20°C |
RRID |
AB_2746434 |
The synthetic peptide sequence is 102-138aa, KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GTP for GDP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex. The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors. Activation is terminated by a GTPase intrinsic to the G-alpha subunit. G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: G alpha q; guanine nucleotide binding protein (G protein), q polypeptide; guanine nucleotide binding protein alpha q subunit; guanine nucleotide binding protein, alpha q polypeptide; guanine nucleotide regulatory protein G alpha q; Guanine nucleotide-binding protein alpha-q; Guanine nucleotide-binding protein G(q) subunit alpha; heterotrimeric guanine nucleotide-binding protein alpha q subunit
Gene Aliases: 1110005L02Rik; 6230401I02Rik; AA408290; AW060788; CMC1; Dsk1; Dsk10; G-ALPHA-q; Galphaq; GAQ; GNAQ; Gq; GqI; SWS
UniProt ID: (Human) P50148, (Rat) P82471, (Mouse) P21279
Entrez Gene ID: (Human) 2776, (Rat) 81666, (Mouse) 14682
Molecular Function:
heterotrimeric G-protein
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support