Invitrogen

GNAQ Polyclonal Antibody

Tech Support

Datasheet

Protocols

Questions & Answers

Tech Support

Antibody Testing Data (6)
Published Figures (1)

FIGURE: 1 / 7

GNAQ Antibody (PA5-79318) in WB

Western blot analysis of C1QBP in, Lane 1: human placenta tissue lysates, Lane 2: human Jurkat whole cell lysates, Lane 3: rat brain tissue lysates, Lane 4: mouse brain tissue lysates. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 µg of sample under reducing conditions. After Electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. The membrane was blocked with 5% non-fat milk/TBS fo... View More

Product Image Gallery

GNAQ Antibody in Immunocytochemistry (ICC/IF) — Immunocytochemistry analysis of GNAQ using anti-GNAQ antibody (Product # PA5-79318). GNAQ was detected in a section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-GNAQ antibody (Product # PA5-79318)overnight at 4°C. DyLight®550 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.

GNAQ Antibody in Immunohistochemistry (Paraffin) (IHC (P)) — Immunohistochemistry analysis of GNAQ on paraffin-embedded human prostate cancer tissue. Sample was incubated with GNAQ polyclonal antibody (Product# PA5-79318).

GNAQ Antibody in Flow Cytometry (Flow) — Flow Cytometry of GNAQ in A431 cells (blue line), isotype control rabbit IgG (green line) and unlabeled (red line). Samples were blocked with 10% goat serum, incubated with GNAQ Polyclonal Antibody (Product # PA5-79318) at a dilution of 1 μg (per 1x10^6 cells), followed by DyLight®488 conjugated goat anti-rabbit IgG (for 30 minutes at 20°C) using 5-10 μg (per 1x10^6 cells) dilution.

GNAQ Antibody in Immunohistochemistry (IHC) — Figure 4 Immunohistochemistry stained localization of ST6GAL1, GNAQ, ADFP, and PCNA in UVJ of egg layer breeders with high and low sperm storage capacity. (A-B) ST6GAL1 proteins were localized at epithelial cytoplasm in (A) high-SS and (B) low-SS hen UVJ. (C-D) The positive signals of GANQ antibody were localized at epithelial cell membranes in (C) high-SS and (D) low-SS hen UVJ. (E-F) The strong positive signals of ADFP antibody staining were converged on SST in (E) high-SS and (F) low-SS hen UVJ. (G-H) Positive PCNA signals appeared in all epithelial cells in (G) high-SS and (H) low-SS hen UVJ. (I) The negative control without incubating the primary antibody in immunohistochemistry. Abbreviations: SS, sperm storage; SST, sperm storage tubules; UVJ, uterovaginal junction; A-F and I, Bar, 100 mum. G and H, Bar, 200 mum.

Product Details

PA5-79318

Applications

Tested Dilution

Publications

Western Blot (WB)

0.1-0.5 µg/mL

View 1 publication 1 publication

Immunohistochemistry (IHC)

View 1 publication 1 publication

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL

Immunocytochemistry (ICC/IF)

2 µg/mL

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells

Product Specifications

Species Reactivity

Human, Mouse, Rat

Published species

Human

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human GNAQ (102-138aa KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND).

View immunogen

Conjugate

Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Antigen affinity chromatography

Storage buffer

PBS with 5mg BSA

Contains

0.05mg sodium azide

Storage conditions

-20°C

RRID

AB_2746434

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GTP for GDP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex. The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors. Activation is terminated by a GTPase intrinsic to the G-alpha subunit. G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Product References

Transcriptomic and metabolomic insights into the variety of sperm storage in oviduct of egg layers.

Poultry science

Yang G,Li S,Zhao Q,Chu J,Zhou B,Fan S,Shi F,Wei X,Hu X,Zheng X,Liu Z,Zhou X,Tao Y,Li S,Mou C

Published figure using GNAQ polyclonal antibody (Product # PA5-79318) in Immunohistochemistry

Tue Jun 01 00:00:00 EDT 2021

Minute-scale persistence of a GPCR conformation state triggered by non-cognate G protein interactions primes signaling.

Nature communications

Gupte TM,Ritt M,Dysthe M,Malik RU,Sivaramakrishnan S

PA5-79318 was used in Western Blotting to demonstrate the temporal coupling of cognate and non-cognate G protein interactions through priming of the GPCR conformation.

Wed Oct 23 00:00:00 EDT 2019

Bioinformatics

Protein Aliases: G alpha q; guanine nucleotide binding protein (G protein), q polypeptide; guanine nucleotide binding protein alpha q subunit; guanine nucleotide binding protein, alpha q polypeptide; guanine nucleotide regulatory protein G alpha q; Guanine nucleotide-binding protein alpha-q; Guanine nucleotide-binding protein G(q) subunit alpha; heterotrimeric guanine nucleotide-binding protein alpha q subunit

Gene Aliases: 1110005L02Rik; 6230401I02Rik; AA408290; AW060788; CMC1; Dsk1; Dsk10; G-ALPHA-q; Galphaq; GAQ; GNAQ; Gq; GqI; SWS

UniProt ID: (Human) P50148, (Rat) P82471, (Mouse) P21279

Entrez Gene ID: (Human) 2776, (Rat) 81666, (Mouse) 14682

Molecular Function: heterotrimeric G-protein