Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
The synthetic peptide sequence is 102-138aa, KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GTP for GDP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex. The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors. Activation is terminated by a GTPase intrinsic to the G-alpha subunit. G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: G alpha q; guanine nucleotide binding protein (G protein), q polypeptide; guanine nucleotide binding protein alpha q subunit; guanine nucleotide binding protein, alpha q polypeptide; guanine nucleotide regulatory protein G alpha q; Guanine nucleotide-binding protein alpha-q; Guanine nucleotide-binding protein G(q) subunit alpha; heterotrimeric guanine nucleotide-binding protein alpha q subunit
Gene Aliases: 1110005L02Rik; 6230401I02Rik; AA408290; AW060788; CMC1; Dsk1; Dsk10; G-ALPHA-q; Galphaq; GAQ; GNAQ; Gq; GqI; SWS
UniProt ID: (Human) P50148, (Rat) P82471, (Mouse) P21279
Entrez Gene ID: (Human) 2776, (Rat) 81666, (Mouse) 14682
Molecular Function:
G-protein
enzyme modulator
heterotrimeric G-protein
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support
