Invitrogen

GNAQ Polyclonal Antibody

Product Image Gallery

GNAQ Antibody in Immunohistochemistry (Paraffin) (IHC (P)) — Immunohistochemistry analysis of GNAQ on paraffin-embedded human prostate cancer tissue. Sample was incubated with GNAQ polyclonal antibody (Product# PA5-79318).

GNAQ Antibody in Western Blot (WB) — Western blot analysis of GNAQ in Lane 1: rat ovary tissue lysate, Lane 2: rat testis tissue lysate, Lane 3: mouse testis tissue lysate, Lane 4: 22RV1 whole cell lysate, Lane 5: SKOV whole cell lysate using 40-50 µg per well. Sample was incubated with GNAQ (Product # PA5-79318) at a dilution of 0.5 µg/mL.

Product Details

Tested Applications

Dilution

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL

Western Blot (WB)

0.1-0.5 µg/mL

Product Specifications

Species Reactivity

Human, Mouse, Rat

Host / Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human GNAQ.

Conjugate

Unconjugated

Form

Lyophilized

Purification

Antigen affinity chromatography

Storage buffer

PBS with 5mg BSA

Contains

0.05mg sodium azide

Storage conditions

-20°C

RRID

AB_2746434

Product Specific Information

The synthetic peptide sequence is 102-138aa, KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND

Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.

Target Information

Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GTP for GDP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex. The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors. Activation is terminated by a GTPase intrinsic to the G-alpha subunit. G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Bioinformatics

Protein Aliases: G alpha q; GAQ; GNAQ; guanine nucleotide binding protein (G protein), q polypeptide; guanine nucleotide binding protein alpha q subunit; guanine nucleotide binding protein, alpha q polypeptide; guanine nucleotide regulatory protein G alpha q; Guanine nucleotide-binding protein alpha-q; Guanine nucleotide-binding protein G(q) subunit alpha; heterotrimeric guanine nucleotide-binding protein alpha q subunit

Gene Aliases: 1110005L02Rik; 6230401I02Rik; AA408290; AW060788; CMC1; Dsk1; Dsk10; G-ALPHA-q; Galphaq; GAQ; GNAQ; Gq; GqI; SWS

UniProt ID: (Human) P50148, (Rat) P82471, (Mouse) P21279

Entrez Gene ID: (Human) 2776, (Rat) 81666, (Mouse) 14682

Molecular Function: G-protein enzyme modulator heterotrimeric G-protein