Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence in the middle region of human Hexokinase II. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
-20°C |
RRID |
AB_2746480 |
The synthetic peptide sequence is 460-497aa, AYRLADQHRARQKTLEHLQLSHDQLLEVKRRMKVEME R
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
In vertebrates there are four major glucose-phosphorylating isoenzymes, designated hexokinase I, II, III, and IV. Hexokinase activity is involved in the first step in several metabolic pathways including phosphorylation of glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. Hexokinase is an allosteric enzyme inhibited by its product GLC-6-P. Hexokinase 2 is the predominant hexokinase isozyme expressed in insulin-responsive tissues such as skeletal muscle. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: DKFZp686M1669; Hexokinase; Hexokinase type II; Hexokinase-2; hexokinase-2 muscle; hexokinase-2, muscle; Hexokinase-B; HK II; Muscle form hexokinase; OTTHUMP00000202738
Gene Aliases: AI642394; HK2; HKII; HXK2
UniProt ID: (Human) P52789, (Mouse) O08528, (Rat) P27881
Entrez Gene ID: (Human) 3099, (Mouse) 15277, (Rat) 25059
Molecular Function:
kinase
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support