Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案
          • Primary Antibodies ›
          • HOXB1 Antibodies

          Invitrogen

          HOXB1 Polyclonal Antibody

          View all (15) HOXB1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite HOXB1 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (1)
          HOXB1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          HOXB1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 1

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          HOXB1 Antibody (PA5-95453) in WB

          Western blot analysis of HOXA1/HOXB1/HOXD1 in Lane 1: rat testis tissue lysate, Lane 2: mouse testis tissue lysate, Lane 3: human MCF-7 whole cell lysate. Electrophoresis was performed with 5-20% SDS-PAGE gel (70V, Stacking gel; 90V Resolving gel, Time: 2-3 hours), transferred to a nitrocellulose membrane and blocked using 5% Non-fat Milk/TBS (1.5 hrs at room temperature). Samples were incubated with HOXA1/HOXB1/HOXD1 polyclonal antibody (Product # PA5-95453) using a 0.5 µg/mL dilution, followed by a goat anti-rabbit IgG-HRP at a dilution ... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          HOXB1 Antibody in Western Blot (WB)
          HOXB1 Polyclonal Antibody

          Product Details

          PA5-95453

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human HOXB1 (176-220aa TARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEK).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807256

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: rat testis tissue, mouse testis tissue, human MCF-7 whole cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: homeo box B1; Homeobox protein Hox-2.9; Homeobox protein Hox-2I; Homeobox protein Hox-B1; Hox-29; unnamed protein product

          View more View less

          Gene Aliases: HCFP3; Hox-2.9; HOX2; HOX2I; Hoxb-1; HOXB1

          View more View less

          UniProt ID: (Human) P14653, (Mouse) P17919

          View more View less

          Entrez Gene ID: (Human) 3211, (Mouse) 15407, (Rat) 303491

          View more View less

          Function(s)
          RNA polymerase II regulatory region sequence-specific DNA binding RNA polymerase II core promoter proximal region sequence-specific DNA binding RNA polymerase II transcription factor activity, sequence-specific DNA binding transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding DNA binding transcription factor activity, sequence-specific DNA binding protein domain specific binding sequence-specific DNA binding sequence-specific double-stranded DNA binding homeodomain transcription factor
          Process(es)
          regulation of transcription, DNA-templated regulation of transcription from RNA polymerase II promoter pattern specification process anatomical structure morphogenesis anterior/posterior pattern specification rhombomere development rhombomere 4 development rhombomere 5 development facial nerve structural organization facial nucleus development positive regulation of transcription from RNA polymerase II promoter anatomical structure formation involved in morphogenesis embryonic skeletal system morphogenesis transcription, DNA-templated multicellular organism development
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-blue-744bc48644-5wn4c:80/100.66.76.150:80.
          git-commit: 747bde55a712f6f97bf7760408d445eefba4e16f
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.48.0-Offline