Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Promotions
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central
          • Primary Antibodies ›
          • HSD11B2 Antibodies

          Invitrogen

          HSD11B2 Polyclonal Antibody

          1 Published Figure
          2 References
          View all (12) HSD11B2 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers

          Cite HSD11B2 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (8)
          • Published Figures (1)
          HSD11B2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          HSD11B2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 9

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          HSD11B2 Antibody (PA5-79399) in IHC (P)

          Immunohistochemistry (Paraffin) analysis of HSD11B2 in paraffin-embedded section of human placenta tissue using HSD11B2 Polyclonal Antibody (Product # PA5-79399). Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with the primary antibody at a 5 µg/mL dilution overnight ... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          HSD11B2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          HSD11B2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          HSD11B2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          HSD11B2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          HSD11B2 Antibody in Immunohistochemistry (Frozen) (IHC (F))
          HSD11B2 Antibody in Immunohistochemistry (Frozen) (IHC (F))
          HSD11B2 Antibody in Immunohistochemistry (Frozen) (IHC (F))
          HSD11B2 Antibody in Western Blot (WB)
          HSD11B2 Antibody in Immunohistochemistry (IHC)
          HSD11B2 Polyclonal Antibody

          Product Details

          PA5-79399

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (IHC)

          -
          View 1 publication 1 publication

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          View 1 publication 1 publication

          Immunohistochemistry (Frozen) (IHC (F))

          2-5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Published species

          Rhesus monkey

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human HSD11B2 (277-309aa EKRKQLLLANLPQELLQAYGKDYIEHLHGQFLH).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746515

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: rat kidney tissue, mouse kidney tissue, human placenta tissue. IHC: Mouse Pancreas tissue, Rat Pancreas tissue, Human Placenta tissue IHC-F: human placenta tissue, mouse kidney tissue, rat kidney tissue.

          Target Information

          There are at least two isozymes of the corticosteroid 11-beta-dehydrogenase, a microsomal enzyme complex responsible for the interconversion of cortisol and cortisone. The type I isozyme has both 11-beta-dehydrogenase (cortisol to cortisone) and 11-oxoreductase (cortisone to cortisol) activities. The type II isozyme, encoded by this gene, has only 11-beta-dehydrogenase activity. In aldosterone-selective epithelial tissues such as the kidney, the type II isozyme catalyzes the glucocorticoid cortisol to the inactive metabolite cortisone, thus preventing illicit activation of the mineralocorticoid receptor. In tissues that do not express the mineralocorticoid receptor, such as the placenta and testis, it protects cells from the growth-inhibiting and/or pro-apoptotic effects of cortisol, particularly during embryonic development. Mutations in this gene cause the syndrome of apparent mineralocorticoid excess and hypertension.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: -HSD11 type II; 11(beta)-HSD2; 11-beta-HSD type II; 11-beta-HSD2; 11-beta-hydroxysteroid dehydrogenase type 2; 11-beta-hydroxysteroid dehydrogenase type II; 11-DH2; 11-HSD type II; Corticosteroid 11-beta-dehydrogenase isozyme 2; Hydroxysteroid dehydrogenase, 11 beta type 2; NAD-dependent 11-beta-hydroxysteroid dehydrogenase; Short chain dehydrogenase/reductase family 9C member 3

          View more View less

          Gene Aliases: 11HSD2; AME; AME1; HSD11B2; HSD11K; HSD2; SDR9C3

          View more View less

          UniProt ID: (Human) P80365, (Mouse) P51661, (Rat) P50233

          View more View less

          Entrez Gene ID: (Human) 3291, (Mouse) 15484, (Rat) 25117

          View more View less

          Function(s)
          steroid binding oxidoreductase activity oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor NAD binding 11-beta-hydroxysteroid dehydrogenase (NAD+) activity C-3 sterol dehydrogenase (C-4 sterol decarboxylase) activity 11-beta-hydroxysteroid dehydrogenase [NAD(P)] activity aldo-keto reductase (NADP) activity isocitrate dehydrogenase activity mevaldate reductase activity gluconate dehydrogenase activity steroid dehydrogenase activity epoxide dehydrogenase activity 5-exo-hydroxycamphor dehydrogenase activity 2-hydroxytetrahydrofuran dehydrogenase activity acetoin dehydrogenase activity phenylcoumaran benzylic ether reductase activity D-xylose:NADP reductase activity L-arabinose:NADP reductase activity D-arabinitol dehydrogenase, D-ribulose forming (NADP+) activity steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor steroid dehydrogenase activity, acting on the CH-CH group of donors (R)-(-)-1,2,3,4-tetrahydronaphthol dehydrogenase activity 3-hydroxymenthone dehydrogenase activity very long-chain-3-hydroxyacyl-CoA dehydrogenase activity dihydrotestosterone 17-beta-dehydrogenase activity (R)-2-hydroxyisocaproate dehydrogenase activity L-arabinose 1-dehydrogenase (NADP+) activity L-xylulose reductase (NAD+) activity 3-ketoglucose-reductase activity (R)-2-hydroxyglutarate dehydrogenase activity D-arabinitol dehydrogenase, D-xylulose forming (NADP+) activity dehydrogenase oxidoreductase metabolite interconversion enzyme
          Process(es)
          response to hypoxia regulation of blood volume by renal aldosterone lipid metabolic process female pregnancy steroid metabolic process glucocorticoid metabolic process response to xenobiotic stimulus response to food response to insulin cortisol metabolic process response to steroid hormone response to glucocorticoid metabolic process oxidation-reduction process response to drug
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy Consumer Health Data Privacy Policy
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Notice
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-hznln:80/100.66.79.29:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline