Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Western Blot Products
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Food and Beverage
    • Lab Solutions
    • Pharma and Biopharma
    • Real-Time PCR
    • Semiconductor Analysis
    • Clinical and Diagnostics
    • Digital Solutions
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • See all services
  • Help and Support
    • Order Help
    • Digital Solutions
    • Product Support
    • Technical Information
    • Training and Education
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Special Offers
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
            • Instrument Management
          • Primary Antibodies ›
          • IDO Antibodies

          Invitrogen

          IDO Polyclonal Antibody

          Advanced Verification
          2 References
          View all (108) IDO antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite IDO Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (8)
          • Advanced Verification (3)
          IDO Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          IDO Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 11

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          IDO Antibody (PA5-79437) in ICC/IF

          Immunofluorescence analysis of Indoleamine 2,3-dioxygenase 1 was performed using 70% confluent log phase SK-O-V3 cells. The cells were fixed with 4% paraformaldehyde for 10 minutes, permeabilized with 0.1% Triton™ X-100 for 15 minutes, and blocked with 2% BSA for 45 minutes at room temperature. The cells were labeled with IDO Polyclonal Antibody (Product # PA5-79437) at 2 µg/mL in 0.1% BSA, incubated at 4 degree celsius overnight and then labeled with Donkey anti-Rabbit IgG (H+L) Highly Cross-Adsorbed Secondary Antibody, Alexa Fluor Plus 4... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          IDO Antibody in Immunocytochemistry (ICC/IF)
          IDO Antibody in Immunocytochemistry (ICC/IF)
          IDO Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          IDO Antibody in Western Blot (WB)
          IDO Antibody in Western Blot (WB)
          IDO Antibody in Western Blot (WB)
          IDO Antibody in Flow Cytometry (Flow)
          IDO Antibody in Flow Cytometry (Flow)
          IDO Antibody
          IDO Antibody
          IDO Antibody
          IDO Polyclonal Antibody

          Product Details

          PA5-79437

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          View 2 publications 2 publications

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          2 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human

          Published species

          Human, Mouse

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human IDO1 (37-69aa NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746553

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human placenta tissue. IHC: Human Lung Cancer tissue. ICC/IF: A431 cell. Flow: A431 cell.

          Target Information

          IDO1 is an intracellular heme-containing enzyme that catalyzes the oxidative cleavage of the indole ring of several important regulatory molecules like tryptophan, serotonin, and melatonin. By doing this, IDO1 initiates the production of biologically active metabolites, commonly referred to as kynurenines. IDO1 is widely expressed in a variety of human tissues as well as in macrophages and dendritic cells (DCs). In inflammation, interferons (IFNs) act on specific receptors to trigger IDO1 induction. The production of IFN-gamma and induction of IDO1 represent important antimicrobial mechanisms. Degradation and depletion of tryptophan by IDO1 inhibits the growth of viruses, bacteria and parasites. Furthermore, IDO1 plays a complex and crucial role in immunoregulation during infection, pregnancy, autoimmunity, transplantation, and neoplasia.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: EC 1.13.11.52; IDO-1; indolamine 2,3 dioxygenase; indole 2,3-dioxygenase; indoleamine; indoleamine 2,3-dioxygenase (IDO) (EC 1.13.11.17); Indoleamine 2,3-dioxygenase 1; Indoleamine-2; Indoleamine-pyrrole 2,3-dioxygenase; unnamed protein product

          View more View less

          Gene Aliases: IDO; IDO-1; IDO1; INDO

          View more View less

          UniProt ID: (Human) P14902

          View more View less

          Entrez Gene ID: (Human) 3620

          View more View less

          Function(s)
          tryptophan 2,3-dioxygenase activity electron carrier activity oxidoreductase activity heme binding indoleamine 2,3-dioxygenase activity metal ion binding dioxygenase activity
          Process(es)
          immune system process positive regulation of T cell tolerance induction positive regulation of chronic inflammatory response positive regulation of type 2 immune response tryptophan catabolic process inflammatory response female pregnancy tryptophan catabolic process to kynurenine quinolinate biosynthetic process response to lipopolysaccharide negative regulation of interleukin-10 production positive regulation of interleukin-12 production multicellular organismal response to stress kynurenic acid biosynthetic process 'de novo' NAD biosynthetic process from tryptophan swimming behavior T cell proliferation negative regulation of T cell proliferation positive regulation of apoptotic process regulation of activated T cell proliferation negative regulation of T cell apoptotic process positive regulation of T cell apoptotic process
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Taiwan flag icon
          Taiwan

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-5btrv:80/100.66.77.21:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline