Invitrogen
This Antibody was verified by Knockout to ensure that the antibody binds to the antigen stated.
Product Specifications | |
---|---|
Species Reactivity |
Human |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the N-terminus of human IDO1. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
-20°C |
RRID |
AB_2746553 |
The synthetic peptide sequence is 37-69aa, NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
IDO1 is an intracellular heme-containing enzyme that catalyzes the oxidative cleavage of the indole ring of several important regulatory molecules like tryptophan, serotonin, and melatonin. By doing this, IDO1 initiates the production of biologically active metabolites, commonly referred to as kynurenines. IDO1 is widely expressed in a variety of human tissues as well as in macrophages and dendritic cells (DCs). In inflammation, interferons (IFNs) act on specific receptors to trigger IDO1 induction. The production of IFN-gamma and induction of IDO1 represent important antimicrobial mechanisms. Degradation and depletion of tryptophan by IDO1 inhibits the growth of viruses, bacteria and parasites. Furthermore, IDO1 plays a complex and crucial role in immunoregulation during infection, pregnancy, autoimmunity, transplantation, and neoplasia.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: EC 1.13.11.52; IDO-1; indolamine 2,3 dioxygenase; indole 2,3-dioxygenase; indoleamine; Indoleamine 2,3-dioxygenase 1; Indoleamine-2; Indoleamine-pyrrole 2,3-dioxygenase
Gene Aliases: IDO; IDO-1; IDO1; INDO
UniProt ID: (Human) P14902
Entrez Gene ID: (Human) 3620
Molecular Function:
oxygenase
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support