Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • IGFBP3 Antibodies

          Invitrogen

          IGFBP3 Polyclonal Antibody

          View all (28) IGFBP3 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Protocols
          Questions & Answers
          Tech Support

          Cite IGFBP3 Polyclonal Antibody

          • Antibody Testing Data (2)
          IGFBP3 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          IGFBP3 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 2

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          IGFBP3 Antibody (PA5-79451) in IHC (P)

          Immunohistochemistry analysis of IGFBP3 on paraffin-embedded human intestinal cancer tissue. Sample was incubated with IGFBP3 polyclonal antibody (Product# PA5-79451). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          IGFBP3 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          IGFBP3 Antibody in Western Blot (WB)
          IGFBP3 Polyclonal Antibody

          Product Details

          PA5-79451

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          ELISA (ELISA)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP-3 (214-252aa RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746567

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: rat heart tissue, rat brain tissue, rat liver tissue, rat PC-12 whole cellhuman U-87MG whole cellmouse kidney tissue, mouse heart tissue, mouse brain tissue. IHC: Human Intestinal Cancer tissue.

          Target Information

          IGFBP3 is a gene that belongs to the insulin-like growth factor binding protein (IGFBP) family. The gene encodes a protein that contains both an IGFBP domain and a thyroglobulin type-I domain. This protein is known to form a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. The complex circulates in the plasma and prolongs the half-life of IGFs while also altering their interaction with cell surface receptors. Various isoforms of the gene have been identified through alternate transcriptional splice variants. Diseases associated with IGFBP3 include Insulin-Like Growth Factor I and Acid-Labile Subunit Deficiency.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: acid stable subunit of the 140 K IGF complex; binding protein 29; binding protein 53; BP53; Growth hormone dependent binding protein; growth hormone-dependent binding protein; IBP-3; IGF binding protein 3; IGF-binding protein 3; IGFBP; IGFBP-3; Insulin like growth factor binding protein; insulin-like growth factor binding protein 3; Insulin-like growth factor binding protein 3 precursor; insulin-like growth factor-binding protein (IGF-BP3); Insulin-like growth factor-binding protein 3; tcag7.703

          View more View less

          Gene Aliases: AI649005; BP-53; IBP3; IGF-BP3; IGFBP-3; IGFBP3; IGgfbp3

          View more View less

          UniProt ID: (Human) P17936, (Mouse) P47878, (Rat) P15473

          View more View less

          Entrez Gene ID: (Human) 3486, (Mouse) 16009, (Rat) 24484

          View more View less

          Function(s)
          fibronectin binding protein binding insulin-like growth factor binding protein tyrosine phosphatase activator activity insulin-like growth factor I binding insulin-like growth factor II binding metal ion binding growth factor binding protease inhibitor
          Process(es)
          regulation of cell growth osteoblast differentiation negative regulation of protein phosphorylation protein phosphorylation apoptotic process negative regulation of cell proliferation negative regulation of signal transduction regulation of glucose metabolic process negative regulation of smooth muscle cell migration regulation of apoptotic process positive regulation of apoptotic process positive regulation of catalytic activity positive regulation of MAPK cascade regulation of insulin-like growth factor receptor signaling pathway positive regulation of insulin-like growth factor receptor signaling pathway cellular protein metabolic process type B pancreatic cell proliferation positive regulation of myoblast differentiation negative regulation of smooth muscle cell proliferation regulation of growth
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-green-55658555d6-7l2qm:80/100.66.75.127:80.
          git-commit: ec8e7df5f8fec8d765bd419205f1b5046a016d37
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.41.0-Offline