The synthetic peptide sequence is 78-115aa, FALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTN
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
JAK1 (Janus kinase 1) belongs to the family of non-receptor Janus tyrosine kinases, which regulate a spectrum of cellular functions downstream of activated cytokine receptors in the lympho-hematopoietic system. Immunological stimuli, such as interferons and cytokines, induce recruitment of Stat transcription factors to cytokine receptor-associated JAK1. JAK1 then phosphorylates proximal Stat factors, which subsequently dimerize, translocate to the nucleus and bind to cis elements upstream of target gene promoters to regulate transcription. Upon ligand binding, JAK1 undergoes tyrosine phosphorylation and catalytic activation in an interdependent manner. Phosphorylation of tyrosine residues at positions 1022 and 1023 is believed to function in the activation of catalytic events.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: EC 2.7.10.2; JAK-1; Janus kinase 1; Janus protein tyrosine kinase 1; kinase Jak1; Tyrosine-protein kinase JAK1
Gene Aliases: AA960307; BAP004; C130039L05Rik; JAK1; JAK1A; JAK1B; JTK3
UniProt ID: (Human) P23458
Entrez Gene ID: (Human) 3716, (Rat) 84598, (Mouse) 16451
Molecular Function:
kinase
non-receptor tyrosine protein kinase
protein kinase
transferase
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support